KEGG   Homo sapiens (human): 1212Help
Entry
1212              CDS       T01001                                 

Gene name
CLTB, LCB
Definition
clathrin, light chain B
Orthology
K04645  
clathrin light chain B
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1212 (CLTB)
   04142 Lysosome
    1212 (CLTB)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1212 (CLTB)
  Nervous system
   04721 Synaptic vesicle cycle
    1212 (CLTB)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1212 (CLTB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1212 (CLTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35
AA seq 211 aa AA seqDB search
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT
SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgactttggcttcttctcgtcgtcggagagcggtgccccggaggcggcggag
gaggacccggcggccgccttcctggcccagcaggagagcgagattgcaggcatagagaac
gacgagggcttcggggcacctgccggcagccatgcggcccccgcgcagccgggccccacg
agtggggctggttctgaggacatggggaccacagtcaatggagatgtgtttcaggaggcc
aacggtcctgctgatggctacgcagccattgcccaggctgacaggctgacccaggagcct
gagagcatccgcaagtggcgagaggagcagaggaaacggctgcaagagctggatgctgca
tctaaggtcacggaacaggaatggcgggagaaggccaagaaggacctggaggagtggaac
cagcgccagagtgaacaagtagagaagaacaagatcaacaaccgggcatccgaggaggct
ttcgtgaaggaatccaaggaggagaccccaggcacagagtgggagaaggtggcccagcta
tgtgacttcaaccccaagagcagcaagcagtgcaaagatgtgtcccgcctgcgctcggtg
ctcatgtccctgaagcagacgccactgtcccgctag

DBGET integrated database retrieval system