KEGG   Homo sapiens (human): 121278Help
Entry
121278            CDS       T01001                                 

Gene name
TPH2, ADHD7, NTPH
Definition
tryptophan hydroxylase 2 (EC:1.14.16.4)
Orthology
K00502  
tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    121278 (TPH2)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    121278 (TPH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     121278 (TPH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q21.1
AA seq 490 aa AA seqDB search
MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATE
SGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFN
ELIQLLKFQTTIVTLNPPENIWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHP
GFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYL
KNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQ
YIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFF
TIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF
VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
LNKMNQYLGI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagcaatgatgatgttttccagtaaatactgggcacggagagggttttccctg
gattcagcagtgcccgaagagcatcagctacttggcagctcaacactaaataaacctaac
tctggcaaaaatgacgacaaaggcaacaagggaagcagcaaacgtgaagctgctaccgaa
agtggcaagacagcagttgttttctccttgaagaatgaagttggtggattggtaaaagca
ctgaggctctttcaggaaaaacgtgtcaacatggttcatattgaatccaggaaatctcgg
cgaagaagttctgaggttgaaatctttgtggactgtgagtgtgggaaaacagaattcaat
gagctcattcagttgctgaaatttcaaaccactattgtgacgctgaatcctccagagaac
atttggacagaggaagaagagctagaggatgtgccctggttccctcggaagatctctgag
ttagacaaatgctctcacagagttctcatgtatggttctgagcttgatgctgaccaccca
ggatttaaggacaatgtctatcgacagagaagaaagtattttgtggatgtggccatgggt
tataaatatggtcagcccattcccagggtggagtatactgaagaagaaactaaaacttgg
ggtgttgtattccgggagctctccaaactctatcccactcatgcttgccgagagtatttg
aaaaacttccctctgctgactaaatactgtggctacagagaggacaatgtgcctcaactc
gaagatgtctccatgtttctgaaagaaaggtctggcttcacggtgaggccggtggctgga
tacctgagcccacgagactttctggcaggactggcctacagagtgttccactgtacccag
tacatccggcatggctcagatcccctctacaccccagaaccagacacatgccatgaactc
ttgggacatgttccactacttgcggatcctaagtttgctcagttttcacaagaaataggt
ctggcgtctctgggagcatcagatgaagatgttcagaaactagccacgtgctatttcttc
acaatcgagtttggcctttgcaagcaagaagggcaactgcgggcatatggagcaggactc
ctttcctccattggagaattaaagcacgccctttctgacaaggcatgtgtgaaagccttt
gacccaaagacaacttgcttacaggaatgccttatcaccaccttccaggaagcctacttt
gtttcagaaagttttgaagaagccaaagaaaagatgagggactttgcaaagtcaattacc
cgtcccttctcagtatacttcaatccctacacacagagtattgaaattctgaaagacacc
agaagtattgaaaatgtggtgcaggaccttcgcagcgacttgaatacagtgtgtgatgct
ttaaacaaaatgaaccaatatctggggatttga

DBGET integrated database retrieval system