KEGG   Homo sapiens (human): 1213Help
Entry
1213              CDS       T01001                                 

Gene name
CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1213 (CLTC)
   04142 Lysosome
    1213 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1213 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    1213 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1213 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1213 (CLTC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1213 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 1679 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKGIKESGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISL
NTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNR
VVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTP
PTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMN
RISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNN
LAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQ
YFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLAL
SVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQML
VQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVA
DAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFG
SLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLG
SIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLII
VCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVV
RGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRE
NPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELW
GSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNS
VFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFD
VNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSS
YMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNA
HIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEV
CFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGM
FTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAII
TMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAV
NYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLA
QRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQW
FLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDAS
ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccctgactatggagtctgacaaattcatctgcatt
agagaaaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagctagcaaagtaatt
gcactgaaaggtataaaagaatctgggaaaactcttcagatttttaacattgaaatgaaa
agtaaaatgaaggctcataccatgactgatgatgtcaccttttggaaatggatctctttg
aatacggttgctcttgttacggataatgcagtttatcactggagtatggaaggagagtct
cagccagtgaaaatgtttgatcgccattctagccttgcagggtgccagattatcaattac
cgtacagatgcaaaacaaaagtggttacttctgactggtatatctgcacagcaaaatcgt
gtggtgggagctatgcagctatattctgtagataggaaagtgtctcagcccattgaagga
catgcagctagctttgcacagtttaagatggaaggaaatgcagaagaatcaacgttattt
tgttttgcagttcggggccaagctggagggaagttacatattattgaagttggcacacca
cctacagggaaccagccctttccaaagaaggcagtggatgtcttctttcctccagaagca
caaaatgattttcctgttgcaatgcagatcagtgaaaagcatgatgtggtgttcttgata
accaagtatggttatatccacctctatgatcttgagactggtacctgcatctacatgaat
agaatcagtggagaaacaatttttgttactgcacctcatgaagccacagctggaataatt
ggagtaaacagaaagggacaagttctgtcagtgtgtgtggaagaagaaaacataattcct
tacatcaccaatgttctacaaaatcctgatttggctctgagaatggctgtacgtaataac
ttagccggtgctgaagaactctttgcccggaaatttaatgctctttttgcccagggaaat
tactcggaggcagcaaaggtggctgctaatgcaccaaagggaattcttcgtactccagac
actatccgtcggttccagagtgtcccagcccagccaggtcaaacttctcctctacttcag
tactttggtatccttttggaccagggacagctcaacaaatacgaatccttagagctttgt
aggcctgtacttcagcaagggcgaaaacagcttttggagaaatggttaaaagaagataag
ctggaatgttctgaagaactgggtgatcttgtgaaatctgtggaccctacattggcactt
agtgtgtacctaagggctaacgtcccaaataaagtcattcagtgctttgcagaaacaggt
caagtccaaaagattgttttatatgctaaaaaagttggatacactccagattggatattt
ctgctgagaaatgtaatgcgaatcagtccagatcagggacagcagtttgcccaaatgtta
gttcaagatgaagagcctcttgctgacatcacacagattgtagatgtctttatggaatac
aatctaattcagcagtgtactgcattcttgcttgatgctctgaagaataatcgcccatct
gaaggtcctttacagacgcggttacttgagatgaaccttatgcatgcgcctcaagttgca
gatgctattctaggcaatcagatgttcacacattatgaccgggctcatattgctcaactg
tgtgaaaaggctggcctactgcagcgtgcattagaacatttcactgatttatatgatata
aaacgtgcagtggttcacacccatcttcttaaccctgagtggttagtcaactactttggt
tccttatcagtagaagactccctagaatgtctcagagccatgctgtctgccaacatccgt
cagaatctgcagatttgtgttcaggtggcttctaaatatcatgaacaactgtcaactcag
tctctgattgaactttttgaatctttcaagagttttgaaggtctcttttattttctggga
tccattgttaactttagccaggacccagatgtgcactttaaatatattcaggcagcttgc
aagactgggcaaatcaaagaagtagaaagaatctgtagagaaagcaactgctacgatcct
gagcgagtcaagaattttcttaaggaagcaaaactaacagatcagctaccacttatcatt
gtgtgtgatcgatttgactttgtccatgatttggtgctctatttatatagaaataatctt
caaaagtatatagagatatatgtacagaaggtgaatccaagtcgacttcctgtagttatt
ggaggattacttgatgttgactgttctgaagatgtcataaaaaacttgattcttgttgta
agaggtcaattctctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaa
ctgcttctgccttggctagaggccagaattcatgagggctgtgaggagcctgctactcac
aatgccttagccaaaatctacatagacagtaataacaacccggagagatttcttcgtgaa
aatccctactatgacagtcgcgttgttggaaagtattgtgagaagagagatccacatctg
gcctgtgttgcttatgaacgtggccaatgtgatctggaacttattaatgtttgcaatgag
aattccctcttcaaaagtctttctcgctacctggtacgtcgaaaggatccagaattgtgg
ggcagcgtgctgctggaaagcaatccttacaggagacccctaattgaccaggttgtacaa
acagctttgtctgagactcaggaccctgaagaagtgtcagtaactgtaaaggctttcatg
actgcagaccttcctaatgaactcattgaactgctggagaaaattgtccttgataactct
gtattcagtgaacacaggaatctgcaaaacctccttatcctcactgcaattaaggctgac
cgtacacgtgttatggagtatattaaccgcctggataattatgatgccccagatattgcc
aatatcgccatcagcaatgagctgtttgaagaagcatttgccattttccggaaatttgat
gtcaatacttcagcagttcaggtcttaattgagcatattggaaacttggatcgggcatat
gagtttgctgaacgttgcaatgaacctgcggtctggagtcaacttgcaaaagcccagttg
cagaaaggaatggtgaaagaagccattgattcttatatcaaagcagatgatccttcctcc
tacatggaagttgttcaggctgccaatactagtggaaactgggaagaactggtgaagtac
ttgcagatggcccgtaagaaggctcgagagtcctatgtggagacagaactgatattcgca
ctggctaaaacaaaccgccttgcagagttagaagaatttatcaatggaccaaataatgct
catatccaacaagttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttg
ttgtacaataatgtttccaattttggacgtttggcatctaccctggttcacctgggtgaa
tatcaggcagctgttgatggggctaggaaagctaacagtactcgaacatggaaagaggtc
tgcttcgcctgtgtagatgggaaagaattccgtcttgctcagatgtgtggacttcatatt
gttgtacatgcagatgaattagaagaacttatcaactactatcaggatcgtggctatttt
gaagagctgatcaccatgttggaagcagcactgggacttgagcgagctcacatgggaatg
tttactgaattagctattctatactctaaatttaagcctcagaaaatgagggagcacctg
gagctgttctggtctagagtgaatattcccaaggtgctaagagctgcagaacaagctcat
ctttgggcagaactggtgtttttgtatgacaagtatgaagaatatgataatgccataatt
accatgatgaatcatccaactgatgcctggaaagaagggcaattcaaagatatcattacc
aaggttgccaatgtggaactatactacagagcaatacagttctacttagaattcaagcct
ctgttgttaaatgatttgctgatggtgctgtctccacggttggatcacactcgtgcagtc
aattatttcagcaaggttaaacagctaccactggtgaaaccgtatttgcgttcagttcag
aaccataacaacaaatctgtgaatgaatcattgaacaatctttttattacagaagaagat
tatcaggctctgcgaacatcaatagatgcttatgacaactttgacaatatctcgcttgct
cagcgtttggaaaaacatgaactcattgagttcaggagaattgctgcttatctcttcaaa
ggcaacaatcgctggaaacagagtgtagagctgtgcaagaaagacagcctttacaaggat
gcaatgcagtatgcttctgaatctaaagatactgaattggctgaagaactcctgcagtgg
tttttgcaggaagaaaaaagagagtgctttggagcttgtctgtttacctgttacgatctt
ttaaggccagatgtcgtcctagaaactgcatggaggcacaatatcatggattttgccatg
ccctatttcatccaggtcatgaaggagtacttgacaaaggtggataaattagatgcttca
gaatcactgagaaaagaagaagaacaagctacagagacacaacccattgtttatggtcag
ccccagttgatgctgacagcaggacccagtgttgccgtccctccccaggcaccttttggt
tatggttataccgcaccaccgtatggacagccacagcctggctttgggtacagcatgtga

DBGET integrated database retrieval system