KEGG   Homo sapiens (human): 121504Help
Entry
121504            CDS       T01001                                 

Gene name
HIST4H4, H4/p
Definition
histone cluster 4, H4
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    121504 (HIST4H4)
  Immune diseases
   05322 Systemic lupus erythematosus
    121504 (HIST4H4)
  Substance dependence
   05034 Alcoholism
    121504 (HIST4H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p12.3
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcgaggtaaaggtggcaaggggctgggtaagggaggcgccaagcgccaccgg
aaggtgctgcgggacaatatccaaggcattacaaagccggcgattcgccgtctcgcccga
cgtgggggcgtcaagcgcatttctggtctcatctacgaggagacccggggagtcctcaaa
gtcttcctggagaacgtgatccgtgacgcggtgacttacacggagcacgccaagcgcaag
accgtcacggccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctttatggt
ttcggcggttga

DBGET integrated database retrieval system