KEGG   Homo sapiens (human): 121504Help
Entry
121504            CDS       T01001                                 

Gene name
HIST4H4, H4/p
Definition
(RefSeq) histone cluster 4, H4
  KO
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    121504 (HIST4H4)
  Immune diseases
   05322 Systemic lupus erythematosus
    121504 (HIST4H4)
  Substance dependence
   05034 Alcoholism
    121504 (HIST4H4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    121504 (HIST4H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p12.3
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcgaggtaaaggtggcaaggggctgggtaagggaggcgccaagcgccaccgg
aaggtgctgcgggacaatatccaaggcattacaaagccggcgattcgccgtctcgcccga
cgtgggggcgtcaagcgcatttctggtctcatctacgaggagacccggggagtcctcaaa
gtcttcctggagaacgtgatccgtgacgcggtgacttacacggagcacgccaagcgcaag
accgtcacggccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctttatggt
ttcggcggttga

DBGET integrated database retrieval system