KEGG   Homo sapiens (human): 1230Help
Entry
1230              CDS       T01001                                 

Gene name
CCR1, CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
Definition
(RefSeq) C-C motif chemokine receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
Network
N00212  KSHV vCCL2 to host-cell-protein inhibition
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1230 (CCR1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1230 (CCR1)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1230 (CCR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1230 (CCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1230 (CCR1)
CD molecules [BR:hsa04090]
 Proteins
  1230 (CCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Motif
Other DBs
NCBI-GeneID: 1230
NCBI-ProteinID: NP_001286
OMIM: 601159
HGNC: 1602
Ensembl: ENSG00000163823
Vega: OTTHUMG00000133451
Pharos: P32246(Tchem)
UniProt: P32246 Q5U003
Position
3p21.31
AA seq 355 aa AA seqDB search
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaaactccaaacaccacagaggactatgacacgaccacagagtttgactatggggat
gcaactccgtgccagaaggtgaacgagagggcctttggggcccaactgctgccccctctg
tactccttggtatttgtcattggcctggttggaaacatcctggtggtcctggtccttgtg
caatacaagaggctaaaaaacatgaccagcatctacctcctgaacctggccatttctgac
ctgctcttcctgttcacgcttcccttctggatcgactacaagttgaaggatgactgggtt
tttggtgatgccatgtgtaagatcctctctgggttttattacacaggcttgtacagcgag
atctttttcatcatcctgctgacgattgacaggtacctggccatcgtccacgccgtgttt
gccttgcgggcacggaccgtcacttttggtgtcatcaccagcatcatcatttgggccctg
gccatcttggcttccatgccaggcttatacttttccaagacccaatgggaattcactcac
cacacctgcagccttcactttcctcacgaaagcctacgagagtggaagctgtttcaggct
ctgaaactgaacctctttgggctggtattgcctttgttggtcatgatcatctgctacaca
gggattataaagattctgctaagacgaccaaatgagaagaaatccaaagctgtccgtttg
atttttgtcatcatgatcatcttttttctcttttggaccccctacaatttgactatactt
atttctgttttccaagacttcctgttcacccatgagtgtgagcagagcagacatttggac
ctggctgtgcaagtgacggaggtgatcgcctacacgcactgctgtgtcaacccagtgatc
tacgccttcgttggtgagaggttccggaagtacctgcggcagttgttccacaggcgtgtg
gctgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggtcagc
tccacatctccctccacaggggagcatgaactctctgctgggttctga

DBGET integrated database retrieval system