KEGG   Homo sapiens (human): 1232Help
Entry
1232              CDS       T01001                                 

Gene name
CCR3, CC-CKR-3, CD193, CKR3, CMKBR3
Definition
chemokine (C-C motif) receptor 3
Orthology
K04178  
C-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Viral carcinogenesis
Disease
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1232 (CCR3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1232 (CCR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1232 (CCR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1232 (CCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1232 (CCR3)
Cellular antigens [BR:hsa04090]
 Proteins
  1232 (CCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 373 aa AA seqDB search
MPFGIRMLLRAHKPGRSEMTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYS
LVFTVGLLGNVVVVMILIKYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFG
HGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAV
LAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGI
IKTLLRCPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLV
MLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSV
SPSTAEPELSIVF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgccatttggaataagaatgctgttaagagcacacaagccagggagaagtgaaatgaca
acctcactagatacagttgagacctttggtaccacatcctactatgatgacgtgggcctg
ctctgtgaaaaagctgataccagagcactgatggcccagtttgtgcccccgctgtactcc
ctggtgttcactgtgggcctcttgggcaatgtggtggtggtgatgatcctcataaaatac
aggaggctccgaattatgaccaacatctacctgctcaacctggccatttcggacctgctc
ttcctcgtcacccttccattctggatccactatgtcagggggcataactgggtttttggc
catggcatgtgtaagctcctctcagggttttatcacacaggcttgtacagcgagatcttt
ttcataatcctgctgacaatcgacaggtacctggccattgtccatgctgtgtttgccctt
cgagcccggactgtcacttttggtgtcatcaccagcatcgtcacctggggcctggcagtg
ctagcagctcttcctgaatttatcttctatgagactgaagagttgtttgaagagactctt
tgcagtgctctttacccagaggatacagtatatagctggaggcatttccacactctgaga
atgaccatcttctgtctcgttctccctctgctcgttatggccatctgctacacaggaatc
atcaaaacgctgctgaggtgccccagtaaaaaaaagtacaaggccatccggctcattttt
gtcatcatggcggtgtttttcattttctggacaccctacaatgtggctatccttctctct
tcctatcaatccatcttatttggaaatgactgtgagcggagcaagcatctggacctggtc
atgctggtgacagaggtgatcgcctactcccactgctgcatgaacccggtgatctacgcc
tttgttggagagaggttccggaagtacctgcgccacttcttccacaggcacttgctcatg
cacctgggcagatacatcccattccttcctagtgagaagctggaaagaaccagctctgtc
tctccatccacagcagagccggaactctctattgtgttttag

DBGET integrated database retrieval system