KEGG   Homo sapiens (human): 1233Help
Entry
1233              CDS       T01001                                 

Gene name
CCR4, CC-CKR-4, CD194, CKR4, CMKBR4, ChemR13, HGCN:14099, K5-5
Definition
chemokine (C-C motif) receptor 4
Orthology
K04179  
C-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Viral carcinogenesis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1233 (CCR4)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1233 (CCR4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1233 (CCR4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1233 (CCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1233 (CCR4)
Cellular antigens [BR:hsa04090]
 Proteins
  1233 (CCR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p24
AA seq 360 aa AA seqDB search
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacggatatagcagacaccaccctcgatgaaagcatatacagcaattactat
ctgtatgaaagtatccccaagccttgcaccaaagaaggcatcaaggcatttggggagctc
ttcctgcccccactgtattccttggtttttgtatttggtctgcttggaaattctgtggtg
gttctggtcctgttcaaatacaagcggctcaggtccatgactgatgtgtacctgctcaac
cttgccatctcggatctgctcttcgtgttttccctccctttttggggctactatgcagca
gaccagtgggtttttgggctaggtctgtgcaagatgatttcctggatgtacttggtgggc
ttttacagtggcatattctttgtcatgctcatgagcattgatagatacctggcaattgtg
cacgcggtgttttccttgagggcaaggaccttgacttatggggtcatcaccagtttggct
acatggtcagtggctgtgttcgcctcccttcctggctttctgttcagcacttgttatact
gagcgcaaccatacctactgcaaaaccaagtactctctcaactccacgacgtggaaggtt
ctcagctccctggaaatcaacattctcggattggtgatccccttagggatcatgctgttt
tgctactccatgatcatcaggaccttgcagcattgtaaaaatgagaagaagaacaaggcg
gtgaagatgatctttgccgtggtggtcctcttccttgggttctggacaccttacaacata
gtgctcttcctagagaccctggtggagctagaagtccttcaggactgcacctttgaaaga
tacttggactatgccatccaggccacagaaactctggcttttgttcactgctgccttaat
cccatcatctacttttttctgggggagaaatttcgcaagtacatcctacagctcttcaaa
acctgcaggggcctttttgtgctctgccaatactgtgggctcctccaaatttactctgct
gacacccccagctcatcttacacgcagtccaccatggatcatgatctccatgatgctctg
tag

DBGET integrated database retrieval system