KEGG   Homo sapiens (human): 1234Help
Entry
1234              CDS       T01001                                 

Gene name
CCR5, CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
Definition
chemokine (C-C motif) receptor 5 (gene/pseudogene)
Orthology
K04180  
C-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Toxoplasmosis
Viral carcinogenesis
Disease
H01360  
Allergic rhinitis
Drug target
Maraviroc: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 352 aa AA seqDB search
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgc
caaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccagg
acggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtct
ctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaact
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcag
gtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system