KEGG   Homo sapiens (human): 1234Help
Entry
1234              CDS       T01001                                 

Gene name
CCR5, CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
Definition
(RefSeq) C-C motif chemokine receptor 5 (gene/pseudogene)
  KO
K04180  C-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa05145  Toxoplasmosis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
N00212  KSHV vCCL2 to host-cell-protein inhibition
Disease
H01360  Allergic rhinitis
Drug target
Ancriviroc: D03210
Aplaviroc hydrochloride: D06557
Cenicriviroc (DG01264): D09878 D09879
Maraviroc: D06670
Vicriviroc maleate: D06297
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1234 (CCR5)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1234 (CCR5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1234 (CCR5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1234 (CCR5)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1234 (CCR5)
   05145 Toxoplasmosis
    1234 (CCR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1234 (CCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1234 (CCR5)
CD molecules [BR:hsa04090]
 Proteins
  1234 (CCR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1234
NCBI-ProteinID: NP_000570
OMIM: 601373
HGNC: 1606
Ensembl: ENSG00000160791
Vega: OTTHUMG00000133481
Pharos: P51681(Tclin)
UniProt: P51681 Q38L21
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 352 aa AA seqDB search
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgc
caaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccagg
acggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtct
ctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaact
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcag
gtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system