KEGG   Homo sapiens (human): 1235Help
Entry
1235              CDS       T01001                                 

Gene name
CCR6, BN-1, C-C_CKR-6, CC-CKR-6, CCR-6, CD196, CKR-L3, CKRL3, CMKBR6, DCR2, DRY6, GPR29, GPRCY4, STRL22
Definition
chemokine (C-C motif) receptor 6
Orthology
K04181  
C-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1235 (CCR6)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1235 (CCR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1235 (CCR6)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1235 (CCR6)
Cellular antigens [BR:hsa04090]
 Proteins
  1235 (CCR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q27
AA seq 374 aa AA seqDB search
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFG
LLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKL
LKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISS
STFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKT
LVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT
SETADNDNASSFTM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggaatcaatgaatttcagcgatgttttcgactccagtgaagattattttgtg
tcagtcaatacttcatattactcagttgattctgagatgttactgtgctccttgcaggag
gtcaggcagttctccaggctatttgtaccgattgcctactccttgatctgtgtctttggc
ctcctggggaatattctggtggtgatcacctttgctttttataagaaggccaggtctatg
acagacgtctatctcttgaacatggccattgcagacatcctctttgttcttactctccca
ttctgggcagtgagtcatgccaccggtgcgtgggttttcagcaatgccacgtgcaagttg
ctaaaaggcatctatgccatcaactttaactgcgggatgctgctcctgacttgcattagc
atggaccggtacatcgccattgtacaggcgactaagtcattccggctccgatccagaaca
ctaccgcgcagcaaaatcatctgccttgttgtgtgggggctgtcagtcatcatctccagc
tcaacttttgtcttcaaccaaaaatacaacacccaaggcagcgatgtctgtgaacccaag
taccagactgtctcggagcccatcaggtggaagctgctgatgttggggcttgagctactc
tttggtttctttatccctttgatgttcatgatattttgttacacgttcattgtcaaaacc
ttggtgcaagctcagaattctaaaaggcacaaagccatccgtgtaatcatagctgtggtg
cttgtgtttctggcttgtcagattcctcataacatggtcctgcttgtgacggctgcaaat
ttgggtaaaatgaaccgatcctgccagagcgaaaagctaattggctatacgaaaactgtc
acagaagtcctggctttcctgcactgctgcctgaaccctgtgctctacgcttttattggg
cagaagttcagaaactactttctgaagatcttgaaggacctgtggtgtgtgagaaggaag
tacaagtcctcaggcttctcctgtgccgggaggtactcagaaaacatttctcggcagacc
agtgagaccgcagataacgacaatgcgtcgtccttcactatgtga

DBGET integrated database retrieval system