KEGG   Homo sapiens (human): 1236Help
Entry
1236              CDS       T01001                                 

Gene name
CCR7, BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
Definition
(RefSeq) chemokine (C-C motif) receptor 7
  KO
K04182  
C-C chemokine receptor type 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1236 (CCR7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1236 (CCR7)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1236 (CCR7)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1236 (CCR7)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1236 (CCR7)
Cellular antigens [BR:hsa04090]
 Proteins
  1236 (CCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12-q21.2
AA seq 315 aa AA seqDB search
MYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWV
FGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIW
ILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCY
LVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQ
LNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRR
SSMSVEAETTTTFSP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtactccatcatttgtttcgtgggcctactgggcaatgggctggtcgtgttgacctat
atctatttcaagaggctcaagaccatgaccgatacctacctgctcaacctggcggtggca
gacatcctcttcctcctgacccttcccttctgggcctacagcgcggccaagtcctgggtc
ttcggtgtccacttttgcaagctcatctttgccatctacaagatgagcttcttcagtggc
atgctcctacttctttgcatcagcattgaccgctacgtggccatcgtccaggctgtctca
gctcaccgccaccgtgcccgcgtccttctcatcagcaagctgtcctgtgtgggcatctgg
atactagccacagtgctctccatcccagagctcctgtacagtgacctccagaggagcagc
agtgagcaagcgatgcgatgctctctcatcacagagcatgtggaggcctttatcaccatc
caggtggcccagatggtgatcggctttctggtccccctgctggccatgagcttctgttac
cttgtcatcatccgcaccctgctccaggcacgcaactttgagcgcaacaaggccatcaag
gtgatcatcgctgtggtcgtggtcttcatagtcttccagctgccctacaatggggtggtc
ctggcccagacggtggccaacttcaacatcaccagtagcacctgtgagctcagtaagcaa
ctcaacatcgcctacgacgtcacctacagcctggcctgcgtccgctgctgcgtcaaccct
ttcttgtacgccttcatcggcgtcaagttccgcaacgatctcttcaagctcttcaaggac
ctgggctgcctcagccaggagcagctccggcagtggtcttcctgtcggcacatccggcgc
tcctccatgagtgtggaggccgagaccaccaccaccttctccccatag

DBGET integrated database retrieval system