KEGG   Homo sapiens (human): 1236Help
Entry
1236              CDS       T01001                                 

Gene name
CCR7, BLR2, CD197, CDw197, CMKBR7, EBI1
Definition
chemokine (C-C motif) receptor 7
Orthology
K04182  
C-C chemokine receptor type 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Transcriptional misregulation in cancer
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12-q21.2
AA seq 378 aa AA seqDB search
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacctggggaaaccaatgaaaagcgtgctggtggtggctctccttgtcattttccag
gtatgcctgtgtcaagatgaggtcacggacgattacatcggagacaacaccacagtggac
tacactttgttcgagtctttgtgctccaagaaggacgtgcggaactttaaagcctggttc
ctccctatcatgtactccatcatttgtttcgtgggcctactgggcaatgggctggtcgtg
ttgacctatatctatttcaagaggctcaagaccatgaccgatacctacctgctcaacctg
gcggtggcagacatcctcttcctcctgacccttcccttctgggcctacagcgcggccaag
tcctgggtcttcggtgtccacttttgcaagctcatctttgccatctacaagatgagcttc
ttcagtggcatgctcctacttctttgcatcagcattgaccgctacgtggccatcgtccag
gctgtctcagctcaccgccaccgtgcccgcgtccttctcatcagcaagctgtcctgtgtg
ggcatctggatactagccacagtgctctccatcccagagctcctgtacagtgacctccag
aggagcagcagtgagcaagcgatgcgatgctctctcatcacagagcatgtggaggccttt
atcaccatccaggtggcccagatggtgatcggctttctggtccccctgctggccatgagc
ttctgttaccttgtcatcatccgcaccctgctccaggcacgcaactttgagcgcaacaag
gccatcaaggtgatcatcgctgtggtcgtggtcttcatagtcttccagctgccctacaat
ggggtggtcctggcccagacggtggccaacttcaacatcaccagtagcacctgtgagctc
agtaagcaactcaacatcgcctacgacgtcacctacagcctggcctgcgtccgctgctgc
gtcaaccctttcttgtacgccttcatcggcgtcaagttccgcaacgatctcttcaagctc
ttcaaggacctgggctgcctcagccaggagcagctccggcagtggtcttcctgtcggcac
atccggcgctcctccatgagtgtggaggccgagaccaccaccaccttctccccatag

DBGET integrated database retrieval system