KEGG   Homo sapiens (human): 1237Help
Entry
1237              CDS       T01001                                 

Gene name
CCR8, CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1
Definition
chemokine (C-C motif) receptor 8
Orthology
K04183  
C-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1237 (CCR8)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1237 (CCR8)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1237 (CCR8)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1237 (CCR8)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1237 (CCR8)
Cellular antigens [BR:hsa04090]
 Proteins
  1237 (CCR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22
AA seq 355 aa AA seqDB search
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggattatacacttgacctcagtgtgacaacagtgaccgactactactaccctgatatc
ttctcaagcccctgtgatgcggaacttattcagacaaatggcaagttgctccttgctgtc
ttttattgcctcctgtttgtattcagtcttctgggaaacagcctggtcatcctggtcctt
gtggtctgcaagaagctgaggagcatcacagatgtatacctcttgaacctggccctgtct
gacctgctttttgtcttctccttcccctttcagacctactatctgctggaccagtgggtg
tttgggactgtaatgtgcaaagtggtgtctggcttttattacattggcttctacagcagc
atgtttttcatcaccctcatgagtgtggacaggtacctggctgttgtccatgccgtgtat
gccctaaaggtgaggacgatcaggatgggcacaacgctgtgcctggcagtatggctaacc
gccattatggctaccatcccattgctagtgttttaccaagtggcctctgaagatggtgtt
ctacagtgttattcattttacaatcaacagactttgaagtggaagatcttcaccaacttc
aaaatgaacattttaggcttgttgatcccattcaccatctttatgttctgctacattaaa
atcctgcaccagctgaagaggtgtcaaaaccacaacaagaccaaggccatcaggttggtg
ctcattgtggtcattgcatctttacttttctgggtcccattcaacgtggttcttttcctc
acttccttgcacagtatgcacatcttggatggatgtagcataagccaacagctgacttat
gccacccatgtcacagaaatcatttcctttactcactgctgtgtgaaccctgttatctat
gcttttgttggggagaagttcaagaaacacctctcagaaatatttcagaaaagttgcagc
caaatcttcaactacctaggaagacaaatgcctagggagagctgtgaaaagtcatcatcc
tgccagcagcactcctcccgttcctccagcgtagactacattttgtga

DBGET integrated database retrieval system