KEGG   Homo sapiens (human): 1237Help
Entry
1237              CDS       T01001                                 

Gene name
CCR8, CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1
Definition
chemokine (C-C motif) receptor 8
Orthology
K04183  
C-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Viral carcinogenesis
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22
AA seq 355 aa AA seqDB search
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggattatacacttgacctcagtgtgacaacagtgaccgactactactaccctgatatc
ttctcaagcccctgtgatgcggaacttattcagacaaatggcaagttgctccttgctgtc
ttttattgcctcctgtttgtattcagtcttctgggaaacagcctggtcatcctggtcctt
gtggtctgcaagaagctgaggagcatcacagatgtatacctcttgaacctggccctgtct
gacctgctttttgtcttctccttcccctttcagacctactatctgctggaccagtgggtg
tttgggactgtaatgtgcaaagtggtgtctggcttttattacattggcttctacagcagc
atgtttttcatcaccctcatgagtgtggacaggtacctggctgttgtccatgccgtgtat
gccctaaaggtgaggacgatcaggatgggcacaacgctgtgcctggcagtatggctaacc
gccattatggctaccatcccattgctagtgttttaccaagtggcctctgaagatggtgtt
ctacagtgttattcattttacaatcaacagactttgaagtggaagatcttcaccaacttc
aaaatgaacattttaggcttgttgatcccattcaccatctttatgttctgctacattaaa
atcctgcaccagctgaagaggtgtcaaaaccacaacaagaccaaggccatcaggttggtg
ctcattgtggtcattgcatctttacttttctgggtcccattcaacgtggttcttttcctc
acttccttgcacagtatgcacatcttggatggatgtagcataagccaacagctgacttat
gccacccatgtcacagaaatcatttcctttactcactgctgtgtgaaccctgttatctat
gcttttgttggggagaagttcaagaaacacctctcagaaatatttcagaaaagttgcagc
caaatcttcaactacctaggaagacaaatgcctagggagagctgtgaaaagtcatcatcc
tgccagcagcactcctcccgttcctccagcgtagactacattttgtga

DBGET integrated database retrieval system