KEGG   Homo sapiens (human): 124540Help
Entry
124540            CDS       T01001                                 

Gene name
MSI2, MSI2H
Definition
musashi RNA-binding protein 2
Orthology
K14411  
RNA-binding protein Musashi
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    124540 (MSI2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     124540 (MSI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 328 aa AA seqDB search
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKR
SRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSAN
TVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMV
ECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQ
FPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
AASPQPGSGFGHGIAGPLIATAFTNGYH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaaatgggagccaaggcacctcgggcagcgccaacgactcccagcacgacccc
ggtaaaatgtttatcggtggactgagctggcagacctcaccagatagccttagagactat
tttagcaaatttggagaaattagagaatgtatggtcatgagagatcccactacgaaacgc
tccagaggcttcggtttcgtcacgttcgcagacccagcaagtgtagataaagtattaggt
cagccccaccatgagttagattccaagacgattgaccccaaagttgcatttcctcgtcga
gcgcaacccaagatggtcacaagaacaaagaaaatatttgtaggcgggttatctgcgaac
acagtagtggaagatgtaaagcaatatttcgagcagtttggcaaggtggaagatgcaatg
ctgatgtttgataaaactaccaacaggcacagagggtttggctttgtcacttttgagaat
gaagatgttgtggagaaagtctgtgagattcatttccatgaaatcaataataaaatggta
gaatgtaagaaagctcagccgaaagaagtcatgttcccacctgggacaagaggccgggcc
cggggactgccttacaccatggacgcgttcatgcttggcatggggatgctgggatatccc
aacttcgtggcgacctatggccgtggctaccccggatttgctccaagctatggctatcag
ttcccaggcttcccagcagcggcttatggaccagtggcagcagcggcggtggcggcagca
agaggatcaggctccaacccggcgcggcccggaggcttcccgggggccaacagcccagga
cctgtcgccgatctctacggccctgccagccaggactccggagtggggaattacataagt
gcggccagcccacagccgggctcgggcttcggccacggcatagctggacctttgattgca
acggcctttacaaatggataccattga

DBGET integrated database retrieval system