KEGG   Homo sapiens (human): 124540Help
Entry
124540            CDS       T01001                                 

Gene name
MSI2, MSI2H
Definition
(RefSeq) musashi RNA binding protein 2
  KO
K14411  RNA-binding protein Musashi
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    124540 (MSI2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     124540 (MSI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt NID
Motif
Other DBs
NCBI-GeneID: 124540
NCBI-ProteinID: NP_620412
OMIM: 607897
HGNC: 18585
Ensembl: ENSG00000153944
Vega: OTTHUMG00000178398
Pharos: Q96DH6(Tbio)
UniProt: Q96DH6
Position
17q22
AA seq 328 aa AA seqDB search
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKR
SRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSAN
TVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMV
ECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQ
FPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
AASPQPGSGFGHGIAGPLIATAFTNGYH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaaatgggagccaaggcacctcgggcagcgccaacgactcccagcacgacccc
ggtaaaatgtttatcggtggactgagctggcagacctcaccagatagccttagagactat
tttagcaaatttggagaaattagagaatgtatggtcatgagagatcccactacgaaacgc
tccagaggcttcggtttcgtcacgttcgcagacccagcaagtgtagataaagtattaggt
cagccccaccatgagttagattccaagacgattgaccccaaagttgcatttcctcgtcga
gcgcaacccaagatggtcacaagaacaaagaaaatatttgtaggcgggttatctgcgaac
acagtagtggaagatgtaaagcaatatttcgagcagtttggcaaggtggaagatgcaatg
ctgatgtttgataaaactaccaacaggcacagagggtttggctttgtcacttttgagaat
gaagatgttgtggagaaagtctgtgagattcatttccatgaaatcaataataaaatggta
gaatgtaagaaagctcagccgaaagaagtcatgttcccacctgggacaagaggccgggcc
cggggactgccttacaccatggacgcgttcatgcttggcatggggatgctgggatatccc
aacttcgtggcgacctatggccgtggctaccccggatttgctccaagctatggctatcag
ttcccaggcttcccagcagcggcttatggaccagtggcagcagcggcggtggcggcagca
agaggatcaggctccaacccggcgcggcccggaggcttcccgggggccaacagcccagga
cctgtcgccgatctctacggccctgccagccaggactccggagtggggaattacataagt
gcggccagcccacagccgggctcgggcttcggccacggcatagctggacctttgattgca
acggcctttacaaatggataccattga

DBGET integrated database retrieval system