KEGG   Homo sapiens (human): 125958Help
Entry
125958            CDS       T01001                                 

Gene name
OR7D4, OR19-7, OR19-B, OR19B, OR7D4P, hg105
Definition
olfactory receptor, family 7, subfamily D, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    125958 (OR7D4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    125958 (OR7D4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 312 aa AA seqDB search
MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMY
FFLSNLSFVDICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAY
DRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCE
PAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMGMSSTKGKYKAFST
CGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGA
LERLLSRADSCP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaaaaccttacagaattatcaaaatttctcctcctgggactctcagatgat
cctgaactgcagcccgtcctctttgggctgttcctgtccatgtacctggtcacggtgctg
gggaacctgctcatcattctggccgtcagctctgactcccacctccacacccccatgtac
ttcttcctctccaacctgtcctttgttgacatctgtttcatctccaccacagtccccaag
atgctagtgagcatccaggcacggagcaaagacatctcctacatggggtgcctcactcag
gtgtattttttaatgatgtttgctggaatggatactttcctactggccgtgatggcctat
gaccggtttgtggccatctgccacccactgcactacacggtcatcatgaacccctgcctc
tgtggcctcctggttctggcatcttggttcatcattttctggttctccctggttcatatt
ctactgatgaagaggttgaccttctccacaggcactgagattccgcatttcttctgtgaa
ccggctcaggtcctcaaggtggcctgctctaacaccctcctcaataacattgtcttgtat
gtggccacggcactgctgggtgtgtttcctgtagctgggatcctcttctcctactctcag
attgtctcctccttaatgggaatgtcctccaccaagggcaagtacaaagccttttccacc
tgtggatctcacctctgtgtggtctccttgttctatggaacaggacttggggtctatctg
agttctgctgtgacccattcttcccagagcagctccaccgcctcagtgatgtacgccatg
gtcacccccatgctgaaccccttcatctacagcctgaggaacaaggatgtgaagggggcc
ctggaaagactcctcagcagggccgactcttgtccatga

DBGET integrated database retrieval system