KEGG   Homo sapiens (human): 126328Help
Entry
126328            CDS       T01001                                 

Gene name
NDUFA11, B14.7, CI-B14.7
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa (EC:1.6.5.3)
Orthology
K03956  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    126328 (NDUFA11)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    126328 (NDUFA11)
   05012 Parkinson's disease
    126328 (NDUFA11)
   05016 Huntington's disease
    126328 (NDUFA11)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    126328 (NDUFA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 228 aa AA seqDB search
MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT
FTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARKTGSHCVVQAGLKLLA
SSSPHTSASQSAGIIGMSHCVQRFWVPSSSACLEVLSGESTDVHACSSTRGACNSSGSRP
LPELGARASGSLRKGGHTHPAPRGAGALTPVQALIESLLNTLGSNPRT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaggtttttcgtcagtactgggatatccccgatggcaccgattgccaccgc
aaagcctacagcaccaccagtattgccagcgtcgctggcctgaccgccgctgcctacaga
gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg
ttcactgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtc
cgcgagaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgact
ctgggagcacgcaagacaggatctcactgtgttgtgcaggctggtctcaaactcctggcc
tcgagcagtcctcacacctcagcctcccagagtgctgggattataggcatgagccactgt
gtacagagattctgggtcccttcttccagcgcctgcctcgaagtcctctctggagagagc
acagatgtccacgcgtgttccagcacaaggggggcatgcaacagctcagggtcacgtcca
cttccggagctgggtgcccgggcctcgggctccctgagaaagggcggacacacccacccc
gcacccagaggggcaggggccctgacacctgtccaagccctaatagagtcattgttaaac
actctgggttcgaaccccagaacttga

DBGET integrated database retrieval system