KEGG   Homo sapiens (human): 126961Help
Entry
126961            CDS       T01001                                 

Gene name
HIST2H3C, H3, H3.2, H3/M, H3F2, H3FM, H3FN
Definition
histone cluster 2, H3c
Orthology
K11253  
histone H3
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

DBGET integrated database retrieval system