KEGG   Homo sapiens (human): 1280Help
Entry
1280              CDS       T01001                                 

Gene name
COL2A1, ANFH, AOM, COL11A3, SEDC, STL1
Definition
collagen, type II, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Disease
H00445  
Osteoarthritis with mild chondrodysplasia
H00520  
Type II collagenopathies
H00805  
Vitreoretinal degeneration
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.11
AA seq 1487 aa AA seqDB search
MIRLGAPQTLVLLTLLVAAVLRCQGQDVQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDVKDCLSPEIPFGECCPICPTDLATASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPG
DDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLK
SLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTK
HTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcctcggggctccccagacgctggtgctgctgacgctgctcgtcgccgctgtc
cttcggtgtcagggccaggatgtccaggaggctggcagctgtgtgcaggatgggcagagg
tataatgataaggatgtgtggaagccggagccctgccggatctgtgtctgtgacactggg
actgtcctctgcgacgacataatctgtgaagacgtgaaagactgcctcagccctgagatc
cccttcggagagtgctgccccatctgcccaactgacctcgccactgccagtgggcaacca
ggaccaaagggacagaaaggagaacctggagacatcaaggatattgtaggacccaaagga
cctcctgggcctcagggacctgcaggggaacaaggacccagaggggatcgtggtgacaaa
ggtgaaaaaggtgcccctggacctcgtggcagagatggagaacctgggacccctggaaat
cctggcccccctggtcctcccggcccccctggtccccctggtcttggtggaaactttgct
gcccagatggctggaggatttgatgaaaaggctggtggcgcccagttgggagtaatgcaa
ggaccaatgggccccatgggacctcgaggacctccaggccctgcaggtgctcctgggcct
caaggatttcaaggcaatcctggtgaacctggtgaacctggtgtctctggtcccatgggt
ccccgtggtcctcctggtccccctggaaagcctggtgatgatggtgaagctggaaaacct
ggaaaagctggtgaaaggggtccgcctggtcctcagggtgctcgtggtttcccaggaacc
ccaggccttcctggtgtcaaaggtcacagaggttatccaggcctggacggtgctaaggga
gaggcgggtgctcctggtgtgaagggtgagagtggttccccgggtgagaacggatctccg
ggcccaatgggtcctcgtggcctgcctggtgaaagaggacggactggccctgctggcgct
gcgggtgcccgaggcaacgatggtcagccaggccccgcagggcctccgggtcctgtcggt
cctgctggtggtcctggcttccctggtgctcctggagccaagggtgaagccggccccact
ggtgcccgtggtcctgaaggtgctcaaggtcctcgcggtgaacctggtactcctgggtcc
cctgggcctgctggtgcctccggtaaccctggaacagatggaattcctggagccaaagga
tctgctggtgctcctggcattgctggtgctcctggcttccctgggccacggggccctcct
ggccctcaaggtgcaactggtcctctgggcccgaaaggtcagacgggtgaacctggtatt
gctggcttcaaaggtgaacaaggccccaagggagaacctggccctgctggcccccaggga
gcccctggacccgctggtgaagaaggcaagagaggtgcccgtggagagcctggtggcgtt
gggcccatcggtccccctggagaaagaggtgctcccggcaaccgcggtttcccaggtcaa
gatggtctggcaggtcccaagggagcccctggagagcgagggcccagtggtcttgctggc
cccaagggagccaacggtgaccctggccgtcctggagaacctggccttcctggagcccgg
ggtctcactggccgccctggtgatgctggtcctcaaggcaaagttggcccttctggagcc
cctggtgaagatggtcgtcctggacctccaggtcctcagggggctcgtgggcagcctggt
gtcatgggtttccctggccccaaaggtgccaacggtgagcctggcaaagctggtgagaag
ggactgcctggtgctcctggtctgaggggtcttcctggcaaagatggtgagacaggtgct
gcaggaccccctggccctgctggacctgctggtgaacgaggcgagcagggtgctcctggg
ccatctgggttccagggacttcctggccctcctggtcccccaggtgaaggtggaaaacca
ggtgaccagggtgttcccggtgaagctggagcccctggcctcgtgggtcccaggggtgaa
cgaggtttcccaggtgaacgtggctctcccggtgcccagggcctccagggtccccgtggc
ctccccggcactcctggcactgatggtcccaaaggtgcatctggcccagcaggcccccct
ggggctcagggccctccaggtcttcagggaatgcctggcgagaggggagcagctggtatc
gctgggcccaaaggcgacaggggtgacgttggtgagaaaggccctgagggagcccctgga
aaggatggtggacgaggcctgacaggtcccattggcccccctggcccagctggtgctaat
ggcgagaagggagaagttggacctcctggtcctgcaggaagtgctggtgctcgtggcgct
ccgggtgaacgtggagagactgggccccccggaccagcgggatttgctgggcctcctggt
gctgatggccagcctggggccaagggtgagcaaggagaggccggccagaaaggcgatgct
ggtgcccctggtcctcagggcccctctggagcacctgggcctcagggtcctactggagtg
actggtcctaaaggagcccgaggtgcccaaggccccccgggagccactggattccctgga
gctgctggccgcgttggacccccaggctccaatggcaaccctggaccccctggtccccct
ggtccttctggaaaagatggtcccaaaggtgctcgaggagacagcggcccccctggccga
gctggtgaacccggcctccaaggtcctgctggaccccctggcgagaagggagagcctgga
gatgacggtccctctggtgccgaaggtccaccaggtccccagggtctggctggtcagaga
ggcatcgtcggtctgcctgggcaacgtggtgagagaggattccctggcttgcctggcccg
tcgggtgagcccggcaagcagggtgctcctggagcatctggagacagaggtcctcctggc
cccgtgggtcctcctggcctgacgggtcctgcaggtgaacctggacgagagggaagcccc
ggtgctgatggcccccctggcagagatggcgctgctggagtcaagggtgatcgtggtgag
actggtgctgtgggagctcctggagcccctgggccccctggctcccctggccccgctggt
ccaactggcaagcaaggagacagaggagaagctggtgcacaaggccccatgggaccctca
ggaccagctggagcccggggaatccagggtcctcaaggccccagaggtgacaaaggagag
gctggagagcctggcgagagaggcctgaagggacaccgtggcttcactggtctgcagggt
ctgcccggccctcctggtccttctggagaccaaggtgcttctggtcctgctggtccttct
ggccctagaggtcctcctggccccgtcggtccctctggcaaagatggtgctaatggaatc
cctggccccattgggcctcctggtccccgtggacgatcaggcgaaaccggccctgctggt
cctcctggaaatcctggaccccctggtcctccaggtccccctggccctggcatcgacatg
tccgcctttgctggcttaggcccgagagagaagggccccgaccccctgcagtacatgcgg
gccgaccaggcagccggtggcctgagacagcatgacgccgaggtggatgccacactcaag
tccctcaacaaccagattgagagcatccgcagccccgagggctcccgcaagaaccctgct
cgcacctgcagagacctgaaactctgccaccctgagtggaagagtggagactactggatt
gaccccaaccaaggctgcaccttggacgccatgaaggttttctgcaacatggagactggc
gagacttgcgtctaccccaatccagcaaacgttcccaagaagaactggtggagcagcaag
agcaaggagaagaaacacatctggtttggagaaaccatcaatggtggcttccatttcagc
tatggagatgacaatctggctcccaacactgccaacgtccagatgaccttcctacgcctg
ctgtccacggaaggctcccagaacatcacctaccactgcaagaacagcattgcctatctg
gacgaagcagctggcaacctcaagaaggccctgctcatccagggctccaatgacgtggag
atccgggcagagggcaatagcaggttcacgtacactgccctgaaggatggctgcacgaaa
cataccggtaagtggggcaagactgttatcgagtaccggtcacagaagacctcacgcctc
cccatcattgacattgcacccatggacataggagggcccgagcaggaattcggtgtggac
atagggccggtctgcttcttgtaa

DBGET integrated database retrieval system