KEGG   Homo sapiens (human): 1281Help
Entry
1281              CDS       T01001                                 

Gene name
COL3A1, EDS4A
Definition
collagen, type III, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31
AA seq 1466 aa AA seqDB search
MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSV
LCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRN
GDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPG
PPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPG
ERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPG
SNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAG
ANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPG
AAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPG
SPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPG
PKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAG
TPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKG
EGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPG
VAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPG
KDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAG
PPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDG
LPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAG
SRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRG
PVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGV
GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSS
AEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMD
QASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLP
IVDIAPYDIGGPDQEFGVDVGPVCFL
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctttgtgcaaaaggggagctggctacttctcgctctgcttcatcccactatt
attttggcacaacaggaagctgttgaaggaggatgttcccatcttggtcagtcctatgcg
gatagagatgtctggaagccagaaccatgccaaatatgtgtctgtgactcaggatccgtt
ctctgcgatgacataatatgtgacgatcaagaattagactgccccaacccagaaattcca
tttggagaatgttgtgcagtttgcccacagcctccaactgctcctactcgccctcctaat
ggtcaaggacctcaaggccccaagggagatccaggccctcctggtattcctgggagaaat
ggtgaccctggtattccaggacaaccagggtcccctggttctcctggcccccctggaatc
tgtgaatcatgccctactggtcctcagaactattctccccagtatgattcatatgatgtc
aagtctggagtagcagtaggaggactcgcaggctatcctggaccagctggccccccaggc
cctcccggtccccctggtacatctggtcatcctggttcccctggatctccaggataccaa
ggaccccctggtgaacctgggcaagctggtccttcaggccctccaggacctcctggtgct
ataggtccatctggtcctgctggaaaagatggagaatcaggtagacccggacgacctgga
gagcgaggattgcctggacctccaggtatcaaaggtccagctgggatacctggattccct
ggtatgaaaggacacagaggcttcgatggacgaaatggagaaaagggtgaaacaggtgct
cctggattaaagggtgaaaatggtcttccaggcgaaaatggagctcctggacccatgggt
ccaagaggggctcctggtgagcgaggacggccaggacttcctggggctgcaggtgctcgg
ggtaatgacggtgctcgaggcagtgatggtcaaccaggccctcctggtcctcctggaact
gccggattccctggatcccctggtgctaagggtgaagttggacctgcagggtctcctggt
tcaaatggtgcccctggacaaagaggagaacctggacctcagggacacgctggtgctcaa
ggtcctcctggccctcctgggattaatggtagtcctggtggtaaaggcgaaatgggtccc
gctggcattcctggagctcctggactgatgggagcccggggtcctccaggaccagccggt
gctaatggtgctcctggactgcgaggtggtgcaggtgagcctggtaagaatggtgccaaa
ggagagcccggaccacgtggtgaacgcggtgaggctggtattccaggtgttccaggagct
aaaggcgaagatggcaaggatggatcacctggagaacctggtgcaaatgggcttccagga
gctgcaggagaaaggggtgcccctgggttccgaggacctgctggaccaaatggcatccca
ggagaaaagggtcctgctggagagcgtggtgctccaggccctgcagggcccagaggagct
gctggagaacctggcagagatggcgtccctggaggtccaggaatgaggggcatgcccgga
agtccaggaggaccaggaagtgatgggaaaccagggcctcccggaagtcaaggagaaagt
ggtcgaccaggtcctcctgggccatctggtccccgaggtcagcctggtgtcatgggcttc
cccggtcctaaaggaaatgatggtgctcctggtaagaatggagaacgaggtggccctgga
ggacctggccctcagggtcctcctggaaagaatggtgaaactggacctcagggaccccca
gggcctactgggcctggtggtgacaaaggagacacaggaccccctggtccacaaggatta
caaggcttgcctggtacaggtggtcctccaggagaaaatggaaaacctggggaaccaggt
ccaaagggtgatgccggtgcacctggagctccaggaggcaagggtgatgctggtgcccct
ggtgaacgtggacctcctggattggcaggggccccaggacttagaggtggagctggtccc
cctggtcccgaaggaggaaagggtgctgctggtcctcctgggccacctggtgctgctggt
actcctggtctgcaaggaatgcctggagaaagaggaggtcttggaagtcctggtccaaag
ggtgacaagggtgaaccaggcggtccaggtgctgatggtgtcccagggaaagatggccca
aggggtcctactggtcctattggtcctcctggcccagctggccagcctggagataagggt
gaaggtggtgcccccggacttccaggtatagctggacctcgtggtagccctggtgagaga
ggtgaaactggccctccaggacctgctggtttccctggtgctcctggacagaatggtgaa
cctggtggtaaaggagaaagaggggctccgggtgagaaaggtgaaggaggccctcctgga
gttgcaggaccccctggaggttctggacctgctggtcctcctggtccccaaggtgtcaaa
ggtgaacgtggcagtcctggtggacctggtgctgctggcttccctggtgctcgtggtctt
cctggtcctcctggtagtaatggtaacccaggacccccaggtcccagcggttctccaggc
aaggatgggcccccaggtcctgcgggtaacactggtgctcctggcagccctggagtgtct
ggaccaaaaggtgatgctggccaaccaggagagaagggatcgcctggtgcccagggccca
ccaggagctccaggcccacttgggattgctgggatcactggagcacggggtcttgcagga
ccaccaggcatgccaggtcctaggggaagccctggccctcagggtgtcaagggtgaaagt
gggaaaccaggagctaacggtctcagtggagaacgtggtccccctggaccccagggtctt
cctggtctggctggtacagctggtgaacctggaagagatggaaaccctggatcagatggt
cttccaggccgagatggatctcctggtggcaagggtgatcgtggtgaaaatggctctcct
ggtgcccctggcgctcctggtcatccaggcccacctggtcctgtcggtccagctggaaag
agtggtgacagaggagaaagtggccctgctggccctgctggtgctcccggtcctgctggt
tcccgaggtgctcctggtcctcaaggcccacgtggtgacaaaggtgaaacaggtgaacgt
ggagctgctggcatcaaaggacatcgaggattccctggtaatccaggtgccccaggttct
ccaggccctgctggtcagcagggtgcaatcggcagtccaggacctgcaggccccagagga
cctgttggacccagtggacctcctggcaaagatggaaccagtggacatccaggtcccatt
ggaccaccagggcctcgaggtaacagaggtgaaagaggatctgagggctccccaggccac
ccagggcaaccaggccctcctggacctcctggtgcccctggtccttgctgtggtggtgtt
ggagccgctgccattgctgggattggaggtgaaaaagctggcggttttgccccgtattat
ggagatgaaccaatggatttcaaaatcaacaccgatgagattatgacttcactcaagtct
gttaatggacaaatagaaagcctcattagtcctgatggttctcgtaaaaaccccgctaga
aactgcagagacctgaaattctgccatcctgaactcaagagtggagaatactgggttgac
cctaaccaaggatgcaaattggatgctatcaaggtattctgtaatatggaaactggggaa
acatgcataagtgccaatcctttgaatgttccacggaaacactggtggacagattctagt
gctgagaagaaacacgtttggtttggagagtccatggatggtggttttcagtttagctac
ggcaatcctgaacttcctgaagatgtccttgatgtgcagctggcattccttcgacttctc
tccagccgagcttcccagaacatcacatatcactgcaaaaatagcattgcatacatggat
caggccagtggaaatgtaaagaaggccctgaagctgatggggtcaaatgaaggtgaattc
aaggctgaaggaaatagcaaattcacctacacagttctggaggatggttgcacgaaacac
actggggaatggagcaaaacagtctttgaatatcgaacacgcaaggctgtgagactacct
attgtagatattgcaccctatgacattggtggtcctgatcaagaatttggtgtggacgtt
ggccctgtttgctttttataa

DBGET integrated database retrieval system