KEGG   Homo sapiens (human): 1281Help
Entry
1281              CDS       T01001                                 

Gene name
COL3A1, EDS4A
Definition
(RefSeq) collagen type III alpha 1 chain
  KO
K19720  
collagen, type III, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Platelet activation
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Protein digestion and absorption
Amoebiasis
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04611 Platelet activation
    1281 (COL3A1)
  Endocrine system
   04926 Relaxin signaling pathway
    1281 (COL3A1)
  Digestive system
   04974 Protein digestion and absorption
    1281 (COL3A1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1281 (COL3A1)
  Infectious diseases
   05146 Amoebiasis
    1281 (COL3A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1281 (COL3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P02461(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q32.2
AA seq 1466 aa AA seqDB search
MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSV
LCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRN
GDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPG
PPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPG
ERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPG
SNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAG
ANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPG
AAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPG
SPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPG
PKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAG
TPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKG
EGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPG
VAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPG
KDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAG
PPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDG
LPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAG
SRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRG
PVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGV
GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSS
AEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMD
QASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLP
IVDIAPYDIGGPDQEFGVDVGPVCFL
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctttgtgcaaaaggggagctggctacttctcgctctgcttcatcccactatt
attttggcacaacaggaagctgttgaaggaggatgttcccatcttggtcagtcctatgcg
gatagagatgtctggaagccagaaccatgccaaatatgtgtctgtgactcaggatccgtt
ctctgcgatgacataatatgtgacgatcaagaattagactgccccaacccagaaattcca
tttggagaatgttgtgcagtttgcccacagcctccaactgctcctactcgccctcctaat
ggtcaaggacctcaaggccccaagggagatccaggccctcctggtattcctgggagaaat
ggtgaccctggtattccaggacaaccagggtcccctggttctcctggcccccctggaatc
tgtgaatcatgccctactggtcctcagaactattctccccagtatgattcatatgatgtc
aagtctggagtagcagtaggaggactcgcaggctatcctggaccagctggccccccaggc
cctcccggtccccctggtacatctggtcatcctggttcccctggatctccaggataccaa
ggaccccctggtgaacctgggcaagctggtccttcaggccctccaggacctcctggtgct
ataggtccatctggtcctgctggaaaagatggagaatcaggtagacccggacgacctgga
gagcgaggattgcctggacctccaggtatcaaaggtccagctgggatacctggattccct
ggtatgaaaggacacagaggcttcgatggacgaaatggagaaaagggtgaaacaggtgct
cctggattaaagggtgaaaatggtcttccaggcgaaaatggagctcctggacccatgggt
ccaagaggggctcctggtgagcgaggacggccaggacttcctggggctgcaggtgctcgg
ggtaatgacggtgctcgaggcagtgatggtcaaccaggccctcctggtcctcctggaact
gccggattccctggatcccctggtgctaagggtgaagttggacctgcagggtctcctggt
tcaaatggtgcccctggacaaagaggagaacctggacctcagggacacgctggtgctcaa
ggtcctcctggccctcctgggattaatggtagtcctggtggtaaaggcgaaatgggtccc
gctggcattcctggagctcctggactgatgggagcccggggtcctccaggaccagccggt
gctaatggtgctcctggactgcgaggtggtgcaggtgagcctggtaagaatggtgccaaa
ggagagcccggaccacgtggtgaacgcggtgaggctggtattccaggtgttccaggagct
aaaggcgaagatggcaaggatggatcacctggagaacctggtgcaaatgggcttccagga
gctgcaggagaaaggggtgcccctgggttccgaggacctgctggaccaaatggcatccca
ggagaaaagggtcctgctggagagcgtggtgctccaggccctgcagggcccagaggagct
gctggagaacctggcagagatggcgtccctggaggtccaggaatgaggggcatgcccgga
agtccaggaggaccaggaagtgatgggaaaccagggcctcccggaagtcaaggagaaagt
ggtcgaccaggtcctcctgggccatctggtccccgaggtcagcctggtgtcatgggcttc
cccggtcctaaaggaaatgatggtgctcctggtaagaatggagaacgaggtggccctgga
ggacctggccctcagggtcctcctggaaagaatggtgaaactggacctcagggaccccca
gggcctactgggcctggtggtgacaaaggagacacaggaccccctggtccacaaggatta
caaggcttgcctggtacaggtggtcctccaggagaaaatggaaaacctggggaaccaggt
ccaaagggtgatgccggtgcacctggagctccaggaggcaagggtgatgctggtgcccct
ggtgaacgtggacctcctggattggcaggggccccaggacttagaggtggagctggtccc
cctggtcccgaaggaggaaagggtgctgctggtcctcctgggccacctggtgctgctggt
actcctggtctgcaaggaatgcctggagaaagaggaggtcttggaagtcctggtccaaag
ggtgacaagggtgaaccaggcggtccaggtgctgatggtgtcccagggaaagatggccca
aggggtcctactggtcctattggtcctcctggcccagctggccagcctggagataagggt
gaaggtggtgcccccggacttccaggtatagctggacctcgtggtagccctggtgagaga
ggtgaaactggccctccaggacctgctggtttccctggtgctcctggacagaatggtgaa
cctggtggtaaaggagaaagaggggctccgggtgagaaaggtgaaggaggccctcctgga
gttgcaggaccccctggaggttctggacctgctggtcctcctggtccccaaggtgtcaaa
ggtgaacgtggcagtcctggtggacctggtgctgctggcttccctggtgctcgtggtctt
cctggtcctcctggtagtaatggtaacccaggacccccaggtcccagcggttctccaggc
aaggatgggcccccaggtcctgcgggtaacactggtgctcctggcagccctggagtgtct
ggaccaaaaggtgatgctggccaaccaggagagaagggatcgcctggtgcccagggccca
ccaggagctccaggcccacttgggattgctgggatcactggagcacggggtcttgcagga
ccaccaggcatgccaggtcctaggggaagccctggccctcagggtgtcaagggtgaaagt
gggaaaccaggagctaacggtctcagtggagaacgtggtccccctggaccccagggtctt
cctggtctggctggtacagctggtgaacctggaagagatggaaaccctggatcagatggt
cttccaggccgagatggatctcctggtggcaagggtgatcgtggtgaaaatggctctcct
ggtgcccctggcgctcctggtcatccaggcccacctggtcctgtcggtccagctggaaag
agtggtgacagaggagaaagtggccctgctggccctgctggtgctcccggtcctgctggt
tcccgaggtgctcctggtcctcaaggcccacgtggtgacaaaggtgaaacaggtgaacgt
ggagctgctggcatcaaaggacatcgaggattccctggtaatccaggtgccccaggttct
ccaggccctgctggtcagcagggtgcaatcggcagtccaggacctgcaggccccagagga
cctgttggacccagtggacctcctggcaaagatggaaccagtggacatccaggtcccatt
ggaccaccagggcctcgaggtaacagaggtgaaagaggatctgagggctccccaggccac
ccagggcaaccaggccctcctggacctcctggtgcccctggtccttgctgtggtggtgtt
ggagccgctgccattgctgggattggaggtgaaaaagctggcggttttgccccgtattat
ggagatgaaccaatggatttcaaaatcaacaccgatgagattatgacttcactcaagtct
gttaatggacaaatagaaagcctcattagtcctgatggttctcgtaaaaaccccgctaga
aactgcagagacctgaaattctgccatcctgaactcaagagtggagaatactgggttgac
cctaaccaaggatgcaaattggatgctatcaaggtattctgtaatatggaaactggggaa
acatgcataagtgccaatcctttgaatgttccacggaaacactggtggacagattctagt
gctgagaagaaacacgtttggtttggagagtccatggatggtggttttcagtttagctac
ggcaatcctgaacttcctgaagatgtccttgatgtgcagctggcattccttcgacttctc
tccagccgagcttcccagaacatcacatatcactgcaaaaatagcattgcatacatggat
caggccagtggaaatgtaaagaaggccctgaagctgatggggtcaaatgaaggtgaattc
aaggctgaaggaaatagcaaattcacctacacagttctggaggatggttgcacgaaacac
actggggaatggagcaaaacagtctttgaatatcgaacacgcaaggctgtgagactacct
attgtagatattgcaccctatgacattggtggtcctgatcaagaatttggtgtggacgtt
ggccctgtttgctttttataa

DBGET integrated database retrieval system