KEGG   Homo sapiens (human): 128239Help
Entry
128239            CDS       T01001                                 

Gene name
IQGAP3
Definition
IQ motif containing GTPase activating protein 3
Orthology
K05767  
Ras GTPase-activating-like protein IQGAP2/3
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 1631 aa AA seqDB search
MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRGVAADTVKELMCPEAQLPPVYPVASSMYQL
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGEN
AQRYFDALLKLRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSP
EKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRAN
QDTNTAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPDCANGYQRALESAMAK
KQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPLNTSHLTREEIQSAVTKVTAA
YDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAHWRGYRQRKIY
LEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDI
KIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLF
YLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKS
KVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLYK
NWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALRNLLAMTDKFLLAITSSVDQI
PYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGGA
LAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPT
IPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFH
PGDTLKEILSLSASREQEAAHKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRV
LRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTF
YEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFR
NVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLL
IFLLNKKFLRK
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagagcagcgggcccaggctgggcagcctatgaacgcctcacagctgaggag
atggatgagcagaggcggcagaatgttgcctatcagtacctgtgccggctggaggaggcc
aagcgctggatggaggcctgcctgaaggaggagcttccttccccggtggagctggaggag
agccttcggaatggagtgctgctggccaagctaggccactgttttgcaccctccgtggtt
cccttgaagaagatctacgatgtggagcagctgcggtaccaggcaactggcttacatttc
cgtcacacagacaacatcaacttttggctatctgcaatagcccacatcggtctgccttcg
accttcttcccagagaccacggacatctatgacaaaaagaacatgccccgggtagtctac
tgcatccatgctctcagtctcttcctcttccggctgggattggcccctcagatacatgat
ctatacgggaaagtgaaattcacagctgaggaactcagcaacatggcgtccgaactggcc
aaatatggcctccagctgcctgccttcagcaagatcgggggcatcttggccaatgagctc
tcggtggatgaggctgcagtccatgcagctgttcttgccatcaatgaagcagtggagcga
ggggtggtggaggacaccctggctgccttgcagaatcccagtgctcttctggagaatctc
cgagagcctctggcagccgtctaccaagagatgctggcccaggccaagatggagaaggca
gccaatgccaggaaccatgatgacagagaaagccaggacatctatgaccactacctaact
caggctgaaatccagggcaatatcaaccatgtcaacgtccatggggctctagaagttgtt
gatgatgccctggaaagacagagccctgaagccttgctcaaggcccttcaagaccctgcc
ctggccctgcgaggggtgaggagagactttgctgactggtacctggagcagctgaactca
gacagagagcagaaggcacaggagctgggcctggtggagcttctggaaaaggaggaagtc
caggctggtgtggctgcagccaacacaaagggtgatcaggaacaagccatgctccacgct
gtgcagcggatcaacaaagccatccggaggggagtggcggctgacactgtgaaggagctg
atgtgccctgaggcccagctgcctccagtgtaccctgttgcatcgtctatgtaccagctg
gagctggcagtgctccagcagcagcagggggagcttggccaggaggagctcttcgtggct
gtggagatgctctcagctgtggtcctgattaaccgggccctggaggcccgggatgccagt
ggcttctggagcagcctggtgaaccctgccacaggcctggctgaggtggaaggagaaaat
gcccagcgttacttcgatgccctgctgaaattgcgacaggagcgtgggatgggtgaggac
ttcctgagctggaatgacctgcaggccaccgtgagccaggtcaatgcacagacccaggaa
gagactgaccgggtccttgcagtcagcctcatcaatgaggctctggacaaaggcagccct
gagaagactctgtctgccctactgcttcctgcagctggcctagatgatgtcagcctccct
gtcgcccctcggtaccatctcctccttgtggcagccaaaaggcagaaggcccaggtgaca
ggggatcctggagctgtgctgtggcttgaggagatccgccagggagtggtcagagccaac
caggacactaatacagctcagagaatggctcttggtgtggctgccatcaatcaagccatc
aaggagggcaaggcagcccagactgagcgggtgttgaggaaccccgcagtggcccttcga
ggggtagttcccgactgtgccaacggctaccagcgagccctggaaagtgccatggcaaag
aaacagcgtccagcagacacagctttctgggttcaacatgacatgaaggatggcactgcc
tactacttccatctgcagaccttccaggggatctgggagcaacctcctggctgccccctc
aacacctctcacctgacccgggaggagatccagtcagctgtcaccaaggtcactgctgcc
tatgaccgccaacagctctggaaagccaacgtcggctttgttatccagctccaggcccgc
ctccgtggcttcctagttcggcagaagtttgctgagcattcccactttctgaggacctgg
ctcccagcagtcatcaagatccaggctcattggcggggttataggcagcggaagatttac
ctggagtggttgcagtattttaaagcaaacctggatgccataatcaagatccaggcctgg
gcccggatgtgggcagctcggaggcaatacctgaggcgtctgcactacttccagaagaat
gttaactccattgtgaagatccaggcatttttccgagccaggaaagcccaagatgactac
aggatattagtgcatgcaccccaccctcctctcagtgtggtacgcagatttgcccatctc
ttgaatcaaagccagcaagacttcttggctgaggcagagctgctgaagctccaggaagag
gtagttaggaagatccgatccaatcagcagctggagcaggacctcaacatcatggacatc
aagattggcctgctggtgaagaaccggatcactctgcaggaagtggtctcccactgcaag
aagctgaccaagaggaataaggaacagctgtcagatatgatggttctggacaagcagaag
ggtttaaagtcgctgagcaaagagaaacggcagaaactagaagcataccaacacctcttc
tacctgctccagactcagcccatctacctggccaagctgatctttcagatgccacagaac
aaaaccaccaagttcatggaggcagtgattttcagcctgtacaactatgcctccagccgc
cgagaggcctatctcctgctccagctgttcaagacagcactccaggaggaaatcaagtca
aaggtggagcagccccaggacgtggtgacaggcaacccaacagtggtgaggctggtggtg
agattctaccgtaatgggcggggacagagtgccctgcaggagattctgggcaaggttatc
caggatgtgctagaagacaaagtgctcagcgtccacacagaccctgtccacctctataag
aactggatcaaccagactgaggcccagacagggcagcgcagccatctcccatatgatgtc
accccggagcaggccttgagccaccccgaggtccagagacgactggacatcgccctacgc
aacctcctcgccatgactgataagttccttttagccatcacctcatctgtggaccaaatt
ccgtatgggatgcgatatgtggccaaagtcctgaaggcaactctggcagagaaattccct
gacgccacagacagcgaggtctataaggtggtcgggaacctcctgtactaccgcttcctg
aacccagctgtggtggctcctgacgccttcgacattgtggccatggcagctggtggagcc
ctggctgccccccagcgccatgccctgggggctgtggctcagctcctacagcacgctgcg
gctggcaaggccttctctgggcagagccagcacctacgggtcctgaatgactatctggag
gaaacacacctcaagttcaggaagttcatccatagagcctgccaggtgccagagccagag
gagcgttttgcagtggacgagtactcagacatggtggctgtggccaaacccatggtgtac
atcaccgtgggggagctggtcaacacgcacaggctgttgctggagcaccaggactgcatt
gcccctgatcaccaagaccccctgcatgagctcctggaggatcttggggagctgcccacc
atccctgaccttattggtgagagcatcgctgcagatgggcacacggacctgagcaagcta
gaagtgtccctgacgctgaccaacaagtttgaaggactagaggcagatgctgatgactcc
aacacccgtagcctgcttctgagcaccaagcagctgttggccgatatcatacagttccat
cctggggacaccctcaaggagatcctgtccctctcggcttccagagagcaagaagcagcc
cacaagcagctgatgagccgacgccaggcctgtacagcccagacaccggagccactgcga
cgacaccgctcactgacagctcactccctcctgccactggcagagaagcagcggcgcgtc
ctgcggaacctacgccgacttgaagccctggggttggtcagcgccagaaatggctaccag
gggctagtggacgagctggccaaggacatccgcaaccagcacagacacaggcacaggcgg
aaggcagagctggtgaagctgcaggccacattacagggcctgagcactaagaccaccttc
tatgaggagcagggtgactactacagccagtacatccgggcctgcctggaccacctggcc
cccgactccaagagttctgggaaggggaagaagcagccttctcttcattacactgctgct
cagctcctggaaaagggtgtcttggtggaaattgaagatcttcccgcctctcacttcaga
aacgtcatctttgacatcacgccgggagatgaggcaggaaagtttgaagtaaatgccaag
ttcctgggtgtggacatggagcgatttcagcttcactatcaggatctcctgcagctccag
tatgagggtgtggctgtcatgaaactcttcaacaaggccaaagtcaatgtcaaccttctc
atcttcctcctcaacaagaagtttttgcggaagtga

DBGET integrated database retrieval system