KEGG   Homo sapiens (human): 128312Help
Entry
128312            CDS       T01001                                 

Gene name
HIST3H2BB, H2Bb
Definition
(RefSeq) histone cluster 3 H2B family member b
  KO
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    128312 (HIST3H2BB)
  Immune diseases
   05322 Systemic lupus erythematosus
    128312 (HIST3H2BB)
  Substance dependence
   05034 Alcoholism
    128312 (HIST3H2BB)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    128312 (HIST3H2BB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128312 (HIST3H2BB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8N257(Tbio)
UniProt: 
Position
1q42.13
AA seq 126 aa AA seqDB search
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccagacccgtccaaatcggctcctgcgcccaagaagggttctaaaaaggctgtcacc
aaggcacagaagaaggacggcaagaagcgcaagcgcggccgcaaggagagctattctatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcacactacaacaagcgctccaccatcacgtcccgcgaagtgcagacggccgttcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system