KEGG   Homo sapiens (human): 1284Help
Entry
1284              CDS       T01001                                 

Gene name
COL4A2, ICH, POREN2
Definition
collagen, type IV, alpha 2
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1284 (COL4A2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1284 (COL4A2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    1284 (COL4A2)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1284 (COL4A2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1284 (COL4A2)
   05222 Small cell lung cancer
    1284 (COL4A2)
  Infectious diseases
   05146 Amoebiasis
    1284 (COL4A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1284 (COL4A2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1284 (COL4A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 1712 aa AA seqDB search
MGRDQRAVAGPALRRWLLLGTVTVGFLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGVTGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERD
RYRGEPGEPGLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSLAKG
ARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPAL
YGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGSPGARGPKGWKGDA
GECRCTEGDEAIKGLPGLPGPKGFAGINGEPGRKGDRGDPGQHGLPGFPGLKGVPGNIGA
PGPKGAKGDSRTITTKGERGQPGVPGVPGMKGDDGSPGRDGLDGFPGLPGPPGDGIKGPP
GDPGYPGIPGTKGTPGEMGPPGLGLPGLKGQRGFPGDAGLPGPPGFLGPPGPAGTPGQID
CDTDVKRAVGGDRQEAIQPGCIGGPKGLPGLPGPPGPTGAKGLRGIPGFAGADGGPGPRG
LPGDAGREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQ
PGPRGDAGVPGQPGLKGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGL
HGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGH
PGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGL
AGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL
YGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTG
VQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHG
LPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPG
SPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPG
TPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPG
APGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQ
GRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt NT seq  +upstreamnt  +downstreamnt
atggggagagaccagcgcgcggtggccggccctgccctacggcggtggctgctgctgggg
acagtgaccgtggggttcctcgcccagagcgtcttggcgggtgtgaagaagtttgatgtg
ccgtgtggaggaagagattgcagtgggggctgccagtgctaccctgagaaaggtggacgt
ggtcagcctgggccagtgggcccccaggggtacaatgggccaccaggattacaaggattc
ccgggactgcagggacgtaaaggagacaagggtgaaaggggagcccccggagtaacggga
cccaagggcgacgtgggagcaagaggcgtttctggattccctggtgccgatggaattcct
ggacacccggggcaaggtgggcccaggggaaggccgggctacgatggctgcaacggaacc
cagggagactcaggtccacaggggccccccggctctgaggggttcaccgggcctcccggg
ccccaaggaccaaaagggcagaaaggtgagccttatgcactgcctaaagaggagcgcgac
agatatcggggtgaacctggagagcctggattggtcggtttccagggacctcccggccgc
cctgggcatgtgggacagatgggtccagttggagctccagggagaccaggaccacctgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttctacggagttaagggt
gaaaagggtgacgtagggcagccgggacccaacgggattccatcagacaccctccacccc
atcatcgcgcccacaggagtcaccttccacccagatcagtacaagggtgaaaaaggcagt
gagggggaaccaggaataagaggcatttccttgaagggagaagaaggaatcatgggcttt
cctggactgaggggttaccctggcttgagtggtgaaaaaggatcaccaggacagaaggga
agccgaggcctggatggctatcaagggcctgatggaccccggggacccaagggagaagcc
ggagacccagggccccctggactacctgcctactcccctcacccttccctagcaaaaggt
gccagaggtgacccgggattcccaggggcccaaggggagccaggaagccagggtgagcca
ggagacccgggcctcccaggtccccctggcctctccatcggagatggagatcagaggaga
ggcctgccgggtgagatgggacccaagggcttcatcggagaccccggcatccctgcgctc
tacgggggcccacctggacctgatggaaagcgagggcctccaggaccccccgggctccct
ggaccacctggacctgatggcttcctgtttgggctgaaaggagcaaaaggaagagcaggc
ttccctgggcttcccggctcccctggagcccgcggaccaaaggggtggaaaggtgacgct
ggggaatgcagatgtacagaaggcgacgaagctatcaaaggtcttccgggactgccagga
cccaagggcttcgcaggcatcaacggggagccggggaggaaaggggacagaggagacccc
ggccaacacggcctccctgggttcccagggctcaagggagtgcctggcaacattggtgct
cccggacccaaaggagcaaaaggagattccagaacaatcacaaccaaaggtgagcgggga
cagcccggcgtcccaggtgtgcccgggatgaaaggtgacgatggcagcccaggccgcgat
gggctcgatggattccccggcctcccaggccctcccggtgatggcatcaagggccctcca
ggggacccaggctatccaggaatacctggaacgaagggtactccaggagaaatgggcccc
ccaggactgggccttcccggcctcaaaggccaacgtggtttccctggagacgccggctta
cctggaccaccaggcttcctgggccctcctggccccgcagggaccccaggacaaatagat
tgtgacacagatgtgaaaagggccgttggaggtgacagacaggaggccatccagccaggt
tgcataggagggcccaagggattgccaggcctgccaggacccccaggccccacaggtgcc
aaaggcctccgaggaatcccaggcttcgcaggagctgatggaggaccagggcccaggggc
ttgccaggagacgcaggtcgtgaagggttcccaggacccccagggttcataggaccccga
ggatccaaaggtgcagtgggcctccctggcccagatggatccccaggtcccatcggcctg
ccagggccagatgggccccctggggaaaggggcctccctggagaagtcctgggagctcag
cccgggccacggggagatgctggtgtgcctggacagcctgggcttaaaggccttcccgga
gacagaggcccccctggattcagaggaagccaagggatgcctgggatgccagggctgaag
ggccagccaggcctcccaggaccttccggccagccaggcctgtatgggcctccaggactg
catggattcccaggagctcctggccaagaggggcccttggggctgccaggaatcccaggc
cgtgaaggtctgcctggtgatagaggggaccctggggacacaggcgctcctggccctgtg
ggcatgaaaggtctctctggtgacagaggagatgctggcttcacaggggagcaaggccat
ccaggaagccctggatttaaaggaattgatggaatgcctgggacccccgggctaaaagga
gatagaggctcacctgggatggatggtttccaaggcatgcctggactcaaagggagaccc
gggtttccagggagcaaaggcgaggctggatttttcggaatacccggtctgaagggtctg
gctggtgagccaggttttaaaggcagccgaggggaccctgggcccccaggaccacctcct
gtcatcctgccaggaatgaaagacattaaaggagagaaaggagatgaagggcctatgggg
ctgaaaggatacctgggcgcaaaaggtatccaaggaatgccaggcatcccagggctgtca
ggaatccctgggctgcctgggaggcccggccacatcaaaggagtcaagggagacatcgga
gtccccggcatccccggtttgccaggattccctggggtggctggcccccctggaattacg
ggattcccaggattcataggaagccggggtgacaaaggtgccccagggagagcaggcctg
tatggcgagattggcgcgactggtgatttcggtgacatcggggacactataaatttacca
ggaagaccaggcctgaagggggagcggggcaccactggaataccaggtctgaagggattc
tttggagagaagggaacagaaggtgacatcggcttccctgggataacaggcgtgactgga
gtccaaggccctcctggacttaaaggacaaacaggctttccagggctgactgggcctcca
gggtcgcagggagagctggggcggattggactgcctggtggcaaaggagatgatggctgg
ccgggagctccgggcttaccaggttttccgggactccgtgggatccgcggcttacacggc
ttgccaggcaccaagggctttccaggatccccaggttctgacatccacggagacccaggc
ttcccaggccctcctggggaaagaggtgacccaggagaggccaacacccttccaggccct
gtgggagtcccaggacagaaaggagaccaaggagctccaggggaacgaggcccacctggg
agcccaggacttcaggggttcccaggcatcacacccccttccaacatctctggggcacct
ggtgacaaaggggcgccagggatatttggcctgaaaggttatcggggcccaccagggcca
ccaggttctgctgctcttcctggaagcaaaggtgacacagggaacccaggagctccagga
accccagggaccaaaggatgggccggggactccgggccccagggcaggcctggtgtgttt
ggtctcccaggagaaaaagggcccaggggtgaacaaggcttcatggggaacactggaccc
accggggcggtgggcgacagaggccccaagggacccaagggagacccaggattccctggt
gcccccgggactgtgggagcccccgggattgcaggaatcccccagaagattgccgtccaa
ccagggacagtgggtccccaggggaggcgaggcccccctggggcaccgggggagatgggg
ccccagggcccccccggagaaccaggttttcgtggggctccagggaaagctgggccccaa
ggaagaggtggtgtgtctgctgttcccggcttccggggagatgaaggacccataggccac
caggggccgattggccaagaaggtgcaccaggccgtccagggagcccgggcctgccgggt
atgccaggccgcagcgtcagcatcggctacctcctggtgaagcacagccagacggaccag
gagcccatgtgcccagtgggcatgaacaaactctggagtggatacagcctgctgtacttc
gagggccaggagaaggcgcacaaccaggacctggggctggcgggctcctgcctggcgcgg
ttcagcaccatgcccttcctgtactgcaaccctggtgatgtctgctactatgccagccgg
aacgacaagtcctactggctctctaccactgcgccgctgcccatgatgcccgtggccgag
gacgagatcaagccctacatcagccgctgttctgtgtgtgaggccccggccatcgccatc
gcggtccacagtcaggatgtctccatcccacactgcccagctgggtggcggagtttgtgg
atcggatattccttcctcatgcacacggcggcgggagacgaaggcggtggccaatcactg
gtgtcaccgggcagctgtctagaggacttccgcgccacaccattcatcgaatgcaatgga
ggccgcggcacctgccactactacgccaacaagtacagcttctggctgaccaccattccc
gagcagagcttccagggctcgccctccgccgacacgctcaaggccggcctcatccgcaca
cacatcagccgctgccaggtgtgcatgaagaacctgtga

DBGET integrated database retrieval system