KEGG   Homo sapiens (human): 1287Help
Entry
1287              CDS       T01001                                 

Gene name
COL4A5, ASLN, ATS, CA54
Definition
collagen, type IV, alpha 5
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00581  
Alport syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1287 (COL4A5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1287 (COL4A5)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1287 (COL4A5)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1287 (COL4A5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1287 (COL4A5)
   05222 Small cell lung cancer
    1287 (COL4A5)
  Infectious diseases
   05146 Amoebiasis
    1287 (COL4A5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1287 (COL4A5)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1287 (COL4A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 1685 aa AA seqDB search
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPG
PPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGFP
GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLL
GSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLI
GPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPG
NPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMK
GDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGI
PGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGP
PGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPF
ISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQV
CMKRT
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggcttgttcttactggccctgagtctttgg
gggcagcctgcagaggctgcggcttgctatgggtgttctccaggatcaaagtgtgactgc
agtggcataaaaggggaaaagggagagagagggtttccaggtttggaaggacacccagga
ttgcctggatttccaggtccagaagggcctccggggcctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctggaatgccaggccacgatggggccccaggacctcaaggt
attcccggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggttttcct
ggtttacagggtcctccaggaccccctgggatcccaggtatgaagggtgaaccaggtagt
ataattatgtcatcactgccaggaccaaagggtaatccaggatatccaggtcctcctgga
atacaaggcctacctggtcccactggtataccagggccaattggtcccccaggaccacca
ggtttgatgggccctcctggtccaccaggacttccaggacctaaggggaatatgggctta
aatttccagggacccaaaggtgaaaaaggtgagcaaggtcttcagggcccacctgggcca
cctgggcagatcagtgaacagaaaagaccaattgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccgagggcctcctggacctccagggatacgtggtcctccaggtccc
ccaggtggtgagaaaggtgagaagggtgagcaaggagagccaggcaaaagaggtaaacca
ggcaaagatggagaaaatggccaaccaggaattcctggtttgcctggtgatcctggttac
cctggtgaacccggaagggatggtgaaaagggccaaaaaggtgacactggcccacctgga
cctcctggacttgtaattcctagacctgggactggtataactataggagaaaaaggaaac
attgggttgcctgggttgcctggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggccttcctggacctccaggggctgcagttatgggtcctcctggccctcctgga
tttcctggagaaaggggtcagaaaggtgatgaaggaccacctggaatttccattcctgga
cctcctggacttgacggacagcctggggctcctgggcttccagggcctcctggccctgct
ggccctcacattcctcctagtgatgagatatgtgaaccaggccctccaggccccccagga
tctccaggtgataaaggactccaaggagaacaaggagtgaaaggtgacaaaggtgacact
tgcttcaactgcattggaactggtatttcagggcctccaggtcaacctggtttgccaggt
ctcccaggtcctccaggatctcttggtttccctggacagaaaggggaaaaaggacaagct
ggtgcaactggtcccaaaggattaccaggcattccaggagctccaggtgctccaggcttt
cctggatctaaaggtgaacctggtgatatcctcacttttccaggaatgaagggtgacaaa
ggagagttgggttcccctggagctccagggcttcctggtttacctggcactcctggacag
gatggattgccagggcttcctggcccgaaaggagagcctggtggaattacttttaagggt
gaaagaggtccccctgggaacccaggtttaccaggcctcccagggaatatagggcctatg
ggtccccctggtttcggccctccaggcccagtaggtgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccaggaataccaggtcctaaaggggatccaggtcagactataacc
cagccggggaagcctggcttgcctggtaacccaggcagagatggtgatgtaggtcttcca
ggtgaccctggacttccagggcaaccaggcttgccagggatacctggtagcaaaggagaa
ccaggtatccctggaattgggcttcctggaccacctggtcccaaaggctttcctggaatt
ccaggacctccaggagcacctgggacacctggaagaattggtctagaaggccctcctggg
ccacccggctttccaggaccaaagggtgaaccaggatttgcattacctgggccacctggg
ccaccaggacttccaggtttcaaaggagcacttggtccaaaaggtgatcgtggtttccca
ggacctccgggtcctccaggacgcactggcttagatgggctccctggaccaaaaggtgat
gttggaccaaatggacaacctggaccaatgggacctcctgggctgccaggaataggtgtt
cagggaccaccaggaccaccagggattcctgggccaataggtcaacctggtttacatgga
ataccaggagagaagggggatccaggacctcctggacttgatgttccaggacccccaggt
gaaagaggcagtccagggatccccggagcacctggtcctataggacctccaggatcacca
gggcttccaggaaaagcaggtgcctctggatttccaggtaccaaaggtgaaatgggtatg
atgggacctccaggcccaccaggacctttgggaattcctggcaggagtggtgtacctggt
cttaaaggtgatgatggcttgcagggtcagccaggacttcctggccctacaggagaaaaa
ggtagtaaaggagagcctggccttccaggccctcctggaccaatggatccaaatcttctg
ggctcaaaaggagagaagggggaacctggcttaccaggtatacctggagtttcagggcca
aaaggttatcagggtttgcctggagacccagggcaacctggactgagtggacaacctgga
ttaccaggaccaccaggtcccaaaggtaaccctggtctccctggacagccaggtcttata
ggacctcctggacttaaaggaaccatcggtgatatgggttttccagggcctcagggtgtg
gaagggcctcctggaccttctggagttcctggacaacctggctccccaggattacctgga
cagaaaggcgacaaaggtgatcctggtatttcaagcattggtcttccaggtcttcctggt
ccaaagggtgagcctggtctgcctggatacccagggaaccctggtatcaaaggttctgtg
ggagatcctggtttgcccggattaccaggaacccctggagcaaaaggacaaccaggcctt
cctggattcccaggaaccccaggccctcctggaccaaaaggtattagtggccctcctggg
aaccccggccttccaggagaacctggtcctgtaggtggtggaggtcatcctgggcaacca
gggcctccaggcgaaaaaggcaaacccggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaaacccaggaccccctggacttccaggactt
tctggccaaaagggtgatggaggattacctgggattccaggaaatcctggccttccaggt
ccaaagggcgaaccaggctttcacggtttccctggtgtgcagggtcccccaggccctcct
ggttctccgggtccagctctggaaggacctaaaggcaaccctgggccccaaggtcctcct
gggagaccaggtctaccaggtccagaaggtcctccaggtctccctggaaatggaggtatt
aaaggagagaagggaaatccaggccaacctgggctacctggcttgcctggtttgaaagga
gatcaaggaccaccaggactccagggtaatcctggccggccgggtctcaatggaatgaaa
ggagatcctggtctccctggtgttccaggattcccaggcatgaaaggacccagtggagta
cctggatcagctggccctgagggggaaccgggacttattggtcctccaggtcctcctgga
ttacctggtccttcaggacagagtatcataattaaaggagatgctggtcctccaggaatc
cctggccagcctgggctaaagggtctaccaggaccccaaggacctcaaggcttaccaggt
ccaactggccctccaggagatcctggacgcaatggactccctggctttgatggtgcagga
gggcgcaaaggagacccaggtctgccaggacagccaggtacccgtggtttggatggtccc
cctggtccagatggattgcaaggtcccccaggtccccctggaacctcctctgttgcacat
ggatttcttattacacgccacagccagacaacggatgcaccacaatgcccacagggaaca
cttcaggtctatgaaggcttttctctcctgtatgtacaaggaaataaaagagcccacggt
caagacttggggacggctggcagctgccttcgtcgctttagtaccatgcctttcatgttc
tgcaacatcaataatgtttgcaactttgcttcaagaaatgactattcttactggctctct
accccagagcccatgccaatgagcatgcaacccctaaagggccagagcatccagccattc
attagtcgatgtgcagtatgtgaagctccagctgtggtgatcgcagttcacagtcagacg
atccagattccccattgtcctcagggatgggattctctgtggattggttattccttcatg
atgcatacaagtgcaggggcagaaggctcaggtcaagccctagcctcccctggttcctgc
ttggaagagtttcgttcagctcccttcatcgaatgtcatgggaggggtacctgtaactac
tatgccaactcctacagcttttggctggcaactgtagatgtgtcagacatgttcagtaaa
cctcagtcagaaacgctgaaagcaggagacttgaggacacgaattagccgatgtcaagtg
tgcatgaagaggacataa

DBGET integrated database retrieval system