KEGG   Homo sapiens (human): 128866Help
Entry
128866            CDS       T01001                                 

Gene name
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Definition
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  
charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Disease
H01202  
Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 224 aa AA seqDB search
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

DBGET integrated database retrieval system