KEGG   Homo sapiens (human): 128866Help
Entry
128866            CDS       T01001                                 

Gene name
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Definition
charged multivesicular body protein 4B
Orthology
K12194  
charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Disease
H01202  
Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 224 aa AA seqDB search
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

DBGET integrated database retrieval system