KEGG   Homo sapiens (human): 1289Help
Entry
1289              CDS       T01001                                 

Gene name
COL5A1
Definition
collagen, type V, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1289 (COL5A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1289 (COL5A1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1289 (COL5A1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    1289 (COL5A1)
  Digestive system
   04974 Protein digestion and absorption
    1289 (COL5A1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    1289 (COL5A1)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1289 (COL5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.2-q34.3
AA seq 1838 aa AA seqDB search
MDVHTRWKARSALRPGAPLLPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTG
FCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
NEQGIQQIGLELGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRIALSVHKKNVTLI
LDCKKKTTKFLDRSDHPMIDINGIIVFGTRILDEEVFEGDIQQLLFVSDHRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYYTEGDGEGETYYYEYPYYEDPEDLGKEPTPSKKPVEAA
KETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEG
EENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPY
YDPTSSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLP
GPPGTMGPTGQVGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPMVS
AQESQAQAILQQARLALRGPAGPMGLTGRPGPVGPPGSGGLKGEPGDVGPQGPRGVQGPP
GPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGPPGDD
GERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPGPP
GQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPP
GPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGED
GPEGPKGRGGPNGDPGPLGPPGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGR
GTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTGFP
GPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPP
GPPGEQGLPGLAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGNEGPP
GPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGLQGPV
GLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEP
GPRGQQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPS
GAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGERGEKGESGPSGAA
GPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPT
GEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLR
GIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEK
GDRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHP
GPPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGNGENYVDYADGMEEIFGSLNSLKL
EIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTC
VFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQ
NVTYHCYQSVAWQDAATGSYDKALRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKTVL
EIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFMG
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggacgtccatacccgctggaaagcgcgcagcgcgctccgcccgggcgccccgctgctg
cccccgctgctgctgctgctgctgtgggcgccgcctccgagccgcgcagctcagccagca
gatctcctgaaggttctagattttcacaacttgcctgatggaataacaaagacaacaggc
ttttgcgccacgcggcgatcttccaaaggcccggatgtcgcttacagagtcaccaaagac
gcgcagctcagcgcacccaccaagcagctgtaccctgcgtctgcatttcccgaggacttc
tccatcctaacaactgtgaaagccaagaaaggcagccaggccttcctggtctccatctac
aacgagcagggtatccagcagattgggctggagctgggccgctctcccgtcttcctctac
gaggaccacacggggaagcctggcccggaagactaccccctcttccggggcatcaacctg
tcagatggcaagtggcacagaattgctctcagcgtccacaagaaaaatgtcaccttgatc
ctcgactgtaaaaagaagaccaccaaattcctcgaccgcagcgaccaccccatgatcgac
atcaatggcatcatcgtgtttggcacccggatcctggatgaggaggtgtttgagggtgac
atccagcagctgctctttgtctcggaccaccgggcagcttatgattactgtgagcactac
agccctgactgtgacaccgcagtacctgacaccccacagtcgcaggaccccaatccagat
gaatattacacggaaggagacggcgagggtgagacctattactacgaatacccctactac
gaagaccccgaagacctagggaaggagcccacccccagcaagaagcccgtggaagctgcc
aaagaaaccacagaggtccccgaggagctgaccccgacccccacggaagctgctcccatg
cctgaaaccagtgaaggggctgggaaggaagaggacgtcggcatcggggactatgactac
gtgcccagtgaggactactacacgccctcaccgtatgatgacctcacctatggcgagggg
gaggagaaccccgaccagcccacagacccaggcgctggggccgaaattcccaccagcacc
gccgacacctccaactcctccaatccagctccgcctccaggggaaggtgcggatgacttg
gagggggagttcactgaggaaacgatccggaaccttgacgagaactactacgacccctac
tacgaccccaccagctccccgtcggagatcgggccgggaatgccggcgaaccaggatacc
atctatgaagggattggaggacctcggggcgagaaaggccaaaagggagaaccagcgatt
atcgagccgggcatgctcatcgagggcccgcctggcccagaaggccccgcgggtcttccc
ggacctccaggaaccatgggtcccactggccaagtcggggaccctggagaaaggggcccc
cctggacgcccaggccttcctggggccgatggcctgcccggtcctccaggaaccatgctc
atgctgcccttccggtttggaggtggcggcgatgcgggctccaaaggccccatggtctca
gcccaggagtcccaggcgcaagccattctccagcaggccaggttggcactgaggggacca
gctggcccgatgggtctcacagggagacctggccctgtgggtccccctgggagcggaggt
ttgaagggcgagccgggagacgtggggcctcagggtcctcgaggtgtgcaaggcccgcct
ggtccggccgggaagcccggaagacggggtcgggctgggagtgatggagccagaggaatg
cctggacaaactggccccaagggtgaccggggtttcgacggcctggctgggttgccaggc
gagaagggccacaggggtgaccctggtccttccggcccaccaggacctccgggagacgat
ggagaaaggggtgacgacggagaagttgggcccagggggctgcctggggagcccgggcca
cgtggtctgcttgggccgaaggggcccccaggtcctcccggacctcccggtgtcacgggt
atggacggccagccggggccaaaaggaaatgtgggtccccagggagagcctggcccccca
ggacagcagggtaatccaggcgcccagggtcttccaggcccccagggtgcaattggtcct
ccaggagaaaagggtcccttggggaaaccaggccttccaggaatgcccggtgctgacgga
cccccgggacaccctggcaaagaaggccctccaggagagaaaggaggtcagggtccacct
ggcccccagggtccgattggctacccaggtcctcgaggagtcaagggggccgatggcatc
cgtggtctgaagggcacaaagggcgagaagggtgaagacggctttcctgggtttaaagga
gacatgggcatcaagggtgatcggggggagatcggcccacccggtcccaggggagaagat
ggccctgaaggcccaaagggtcgcggaggtcccaatggtgaccccggtcctctgggaccc
cctggggagaagggaaaactcggagtcccagggttaccagggtatccaggaagacaagga
ccaaagggctctattggattccctggatttcctggcgccaatggagagaagggcggcagg
gggacccctggaaagccaggaccgcgggggcagcgaggcccaacgggtccgaggggtgaa
agaggcccccggggcatcactgggaagcctggccccaagggcaactccggaggtgacggc
ccagctggccctcctggtgaacggggacccaatggaccccaaggacccacaggatttcct
ggaccaaagggcccccctggccctccaggcaaggatggactcccaggacaccctggacag
agaggcgagactggtttccaaggcaagaccggccctccaggcccccccggcgtggtcggc
cctcagggtcccacgggagaaacgggcccaatgggtgagcgtggccaccctgggccccct
ggaccccccggtgaacaggggcttccgggccttgctggaaaagaagggacgaagggtgac
ccaggccctgcaggcctccctgggaaagatggccctccaggattacgtggtttccctggg
gaccgagggcttcctggtccagtgggagctcttggactgaaaggcaatgaagggccccct
ggcccaccaggccctgcgggatctccaggggagagaggtccagctggagccgctgggccc
atcggaattccagggagacctgggccccagggacccccagggccggcaggagagaaaggg
gctcctggcgagaaaggcccacaaggcccagctggccgagacggtctccaggggcctgtg
gggctcccgggtccagctggccctgtgggtccccctggagaagacggagataagggagag
atcggggagccggggcagaaaggaagcaagggggacaaaggagaacagggtcctcctggg
cctacaggtcctcaaggccccatcggacagccaggcccctctggagctgacggcgagccg
gggcctcggggccagcagggccttttcgggcagaaaggtgatgaaggtcccagaggcttt
cctggaccccctgggccagtggggctgcagggtttgccaggacctccaggcgagaagggt
gagacaggagacgtgggccagatgggccccccgggtccccctggcccccgaggaccctcc
ggagctccaggtgctgatggcccacaaggtcccccaggtggaataggaaaccctggtgca
gtgggagagaagggcgagcctggcgaagcaggtgagcctggccttccgggagaaggcggc
cccccgggacccaaaggagaaaggggagagaagggcgagtcaggcccttcaggtgctgcc
ggaccccctggacccaaaggccctcccggagatgatggtcccaaaggcagccctggccca
gtgggttttcctggagatcctggcccccccggagagcctggccccgcgggtcaagatggt
ccccctggtgacaaaggagatgatggtgaacccgggcagacgggatcccccggccctact
ggtgaaccaggtccatcggggcctccaggaaaaaggggtcccccaggccccgcaggcccc
gaaggcagacagggagagaaaggggccaagggagaagccggcttggaaggccctcctggg
aagactggccccatcggcccccagggggcccctgggaagcccggaccggatggccttcga
gggatccctggccctgtgggagaacaaggtctcccaggatccccaggcccggacggtccc
cccggccccatgggtcccccaggacttcccggcctcaaaggagattctggtcccaaaggt
gaaaagggtcatccaggcctgatcgggctcatcggtcctccgggtgaacagggtgagaag
ggcgaccgtggtctccctggcccccagggctcctccggtcctaagggagaacagggtatc
actggtccttctggcccgattgggcctcctgggccccctggcctgccgggtccgcctggt
ccaaaaggtgctaagggctcctcgggtccaactggcccgaagggtgaggcaggccaccca
ggacccccaggccccccgggccccccgggagaggtcatccagcccctgccaatccaggca
tccaggacgcggcggaacatcgacgccagccagctgctggacgacgggaatggcgagaac
tacgtggactacgcggacggcatggaagagatcttcggctctctcaactctctgaagctg
gagattgagcagatgaaacggcccctgggcacgcagcagaaccccgcccgcacctgcaag
gacctgcagctctgccaccccgacttcccagatggtgaatactgggtcgatcctaaccaa
ggatgctccagggattccttcaaggtttactgcaacttcacagccggggggtcgacatgc
gtcttccctgacaagaagtccgaaggggccagaatcacttcttggcccaaagaaaacccg
ggctcctggttcagtgaattcaagcgtgggaaactgctctcctatgtggacgccgagggc
aaccctgtgggtgtggtacagatgaccttcctgcggctgctgagcgcctctgcccaccag
aacgtcacctaccactgctaccagtcagtggcctggcaggacgcagccacgggcagctac
gacaaggccctccgcttcctgggctccaacgacgaggagatgtcctatgacaacaacccc
tacatccgcgccctggtggacggctgtgctaccaagaaaggctaccagaagacggttctg
gagatcgacacccccaaagtggagcaggtgcccatcgtggacatcatgttcaatgacttc
ggtgaagcgtcacagaaatttggatttgaagtggggccggcttgcttcatgggctag

DBGET integrated database retrieval system