KEGG   Homo sapiens (human): 1298Help
Entry
1298              CDS       T01001                                 

Gene name
COL9A2, DJ39G22.4, EDM2, MED, STL5
Definition
collagen, type IX, alpha 2
Orthology
K08131  
collagen, type IX, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00476  
Multiple epiphyseal dysplasia (MED)
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33-p32
AA seq 689 aa AA seqDB search
MAAATASPRSLLVLLQVVVLALAQIRGPPGERGPPGPPGPPGVPGSDGIDGDNGPPGKAG
PPGPKGEPGKAGPDGPDGKPGIDGLTGAKGEPGPMGIPGVKGQPGLPGPPGLPGPGFAGP
PGPPGPVGLPGEIGIRGPKGDPGPDGPSGPPGPPGKPGRPGTIQGLEGSADFLCPTNCPP
GMKGPPGLQGVKGHAGKRGILGDPGHQGKPGPKGDVGASGEQGIPGPPGPQGIRGYPGMA
GPKGETGPHGYKGMVGAIGATGPPGEEGPRGPPGRAGEKGDEGSPGIRGPQGITGPKGAT
GPPGINGKDGTPGTPGMKGSAGQAGQPGSPGHQGLAGVPGQPGTKGGPGDQGEPGPQGLP
GFSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQGPKGEQGPPGIPGPQ
GLPGVKGDKGSPGKTGPRGKVGDPGVAGLPGEKGEKGESGEPGPKGQQGVRGEPGYPGPS
GDAGAPGVQGYPGPPGPRGLAGNRGVPGQPGRQGVEGRDATDQHIVDVALKMLQEQLAEV
AVSAKREALGAVGMMGPPGPPGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKR
GEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGL
PGFCEPAACLGASAYASARLTEPGSIKGP
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctacggcctccccccgcagcctccttgttctcctccaggtggtagtgctc
gctctggcgcagattagaggtccaccgggagagcggggccccccgggtcccccgggaccg
ccgggagtgcctggatccgacggcatcgacggtgacaatgggccccctggaaaagctggc
cctccgggacccaagggcgagcctggcaaagctgggccagatgggccagacgggaagccc
gggattgatggtttaactggagccaagggggagcctggccccatggggatccctggagtc
aagggccagcccgggcttcctggtcctcctggccttccgggccctggttttgctggacct
cctgggcctcctggacctgttggcctccctggtgagattggaatccgaggccccaagggg
gaccctggaccagatggaccatcggggcccccaggaccccctgggaaacctggtcgcccg
ggaaccatccagggtctggaaggcagtgcggatttcctgtgtccaaccaactgtccaccc
ggaatgaaaggtcccccagggctgcagggagtgaaggggcatgcgggcaaacgcgggatt
ctgggtgatcctggccaccaggggaagccgggtcccaagggagatgtgggtgcctctgga
gagcaaggcatccctggaccaccgggtccccagggcatcaggggctacccaggcatggca
gggcccaagggagagacgggccctcatggatataaaggcatggtgggcgctatcggtgcc
actgggccaccgggtgaggaaggtcctaggggaccgccaggccgagctggggagaagggt
gacgagggcagcccaggtattcgtggaccccaggggatcacaggcccgaaaggagcaacg
ggccccccaggcatcaacggcaaggatgggaccccaggcacgcctggcatgaagggcagt
gcaggacaggcgggacagcccggaagtccaggccaccagggcctagcgggtgtgccaggc
cagcctgggacaaaaggaggccctggagaccagggtgagccgggcccgcagggccttcct
ggattctctggtccccctgggaaagagggagagccagggcctcgaggagaaattggtccc
cagggcatcatgggacagaagggtgaccaaggcgagaggggtccagtggggcaaccaggc
cctcagggaaggcagggccctaagggggagcagggcccccccggaattccagggccccaa
ggcttgccaggcgtcaaaggagacaagggctccccagggaagaccgggccccgcggcaaa
gtgggtgacccaggggtggccggcctccccggagagaaaggcgagaagggcgagtccggc
gagccggggcccaagggacagcaaggagtacgtggagaacccggctaccctggccccagc
ggggatgcgggcgccccaggggttcagggctaccctggtccccccggccctcgaggactg
gccgggaaccgaggcgtgccaggacagcccgggagacagggcgtggagggccgggatgcc
actgaccagcacatcgtggatgtggcgctgaagatgctgcaagagcaactggcagaggtc
gccgtgagtgccaagcgggaagccctgggtgcggtgggcatgatgggtcctccaggacct
cctgggccccctgggtacccaggcaagcagggcccccatgggcaccctggccctcggggc
gttcctggcatcgtgggagccgtgggtcagatcggcaacacggggcccaagggaaaacgt
ggagagaagggtgatccaggagaagtgggacgggggcaccccgggatgcctgggccccca
gggatcccaggactccctggccggcctggccaggcaatcaacggcaaggatggagatcga
gggtccccaggggctccaggagaggcaggtcgacctggcctgccaggccccgtggggctg
ccgggcttctgtgaacctgccgcctgccttggagcttcggcctatgcctctgcccgcctt
acagagcctggatccatcaaggggccttga

DBGET integrated database retrieval system