KEGG   Homo sapiens (human): 130Help
Entry
130               CDS       T01001                                 

Gene name
ADH6, ADH-5
Definition
alcohol dehydrogenase 6 (class V) (EC:1.1.1.1)
Orthology
K13952  
alcohol dehydrogenase 6 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Drug target
Fomepizole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    130 (ADH6)
  Lipid metabolism
   00071 Fatty acid degradation
    130 (ADH6)
  Amino acid metabolism
   00350 Tyrosine metabolism
    130 (ADH6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    130 (ADH6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    130 (ADH6)
   00982 Drug metabolism - cytochrome P450
    130 (ADH6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    130 (ADH6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     130 (ADH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q23
AA seq 368 aa AA seqDB search
MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
ELMKTGKW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacaggccaagtcatcagatgcaaagcagccatactctggaagcctggtgca
ccattttctattgaagaggtagaagtggccccaccaaaggcaaaggaagttcgcataaag
gttgtggccaccggactgtgtggtacagagatgaaagtgttggggagtaaacacttggac
ctcttgtatcccaccatcttgggccatgaaggggctggaatcgttgagagtattggagaa
ggagtaagcacagtgaaaccaggtgacaaagttatcacactctttctgccacagtgtgga
gaatgtacctcttgcctgaattctgagggcaatttttgtatacaattcaaacagtcaaaa
acccaactgatgtctgatggtaccagcaggtttacctgcaagggaaaatcaatatatcac
tttggtaataccagcaccttctgtgaatacacagtgataaaggaaatctcagttgccaag
attgatgcagtcgctcctctagagaaagtatgcctaattagctgtggcttttccactggg
tttggtgctgcaatcaatactgccaaggtgactccaggttctacctgtgctgtgtttggc
ctgggaggagtcggcttgtctgttgtcatgggttgtaaagcagcaggagcagccaggatc
attggagtggatgtcaacaaggagaaatttaagaaggcacaggaattgggtgctactgag
tgcctcaaccctcaggacttaaagaaacccattcaagaagttttatttgatatgacagat
gctggtatagacttctgctttgaggccattggaaatctggacgttctggcagctgccctc
gcctcctgcaatgagagctatggggtctgtgtggttgttggggtgttgcctgccagtgtt
caactcaaaatcagtggccagttgttcttctcaggacgttctttgaagggttctgttttt
ggaggctggaagagcagacagcacatccctaaactggttgctgattatatggcagagaag
ttgaatctagatccactaattactcatactctgaatcttgataaaatcaatgaagcagtt
gaattaatgaaaactggaaaatggtaa

DBGET integrated database retrieval system