KEGG   Homo sapiens (human): 130013Help
Entry
130013            CDS       T01001                                 

Gene name
ACMSD
Definition
(RefSeq) aminocarboxymuconate semialdehyde decarboxylase (EC:4.1.1.45)
  KO
K03392  
aminocarboxymuconate-semialdehyde decarboxylase [EC:4.1.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    130013 (ACMSD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.45  aminocarboxymuconate-semialdehyde decarboxylase
     130013 (ACMSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q21.3
AA seq 336 aa AA seqDB search
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRI
REMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQ
APELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQM
DGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
PGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgacatccatagtcatattctaccaaaagaatggccagatctaaaaaagagg
tttggctacggaggctgggtgcagctccaacaccacagcaagggagaagcaaagttgttg
aaagatgggaaagtcttcagagtggtgcgagagaattgctgggatccagaagttcgtatt
agagaaatggaccaaaaaggagtaacagtgcaagccctttccacagttcctgtcatgttt
agctactgggccaaacctgaggacactttaaacctgtgccagcttttaaacaacgacctt
gccagcaccgttgtgagctaccccaggaggttcgtgggtctggggacgttgcccatgcag
gcccctgagctggcggtcaaggagatggagcgctgtgtgaaagagctgggctttcccggg
gtccaaattggcacccacgtcaacgagtgggacctgaacgcgcaggagctctttcctgtc
tatgcggcagccgaaaggctgaagtgttccctgttcgtgcatccctgggacatgcagatg
gatggacgaatggccaaatactggctcccttggcttgtaggaatgccagcagagaccacc
atagccatttgctccatgatcatgggtggagtatttgagaagtttcccaaactgaaagtg
tgtttcgcacatggtggtggtgccttccccttcacagtgggaagaatctcccatggattc
agcatgcgcccagatctgtgtgcccaggacaaccccatgaacccgaagaaataccttggt
tccttttacacagatgctttggttcatgatcctctgtccctcaagctgttaacagatgtc
ataggaaaggataaagtcattttgggaaccgattacccctttccactaggtgagctggaa
cctgggaaactaatagagtccatggaagaatttgatgaagaaacaaagaataaactcaaa
gccggcaatgccctggcatttttgggtcttgagagaaaacaatttgaatga

DBGET integrated database retrieval system