KEGG   Homo sapiens (human): 1312Help
Entry
1312              CDS       T01001                                 

Gene name
COMT, HEL-S-98n
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Drug target
Phloroglucinol: 
Tolcapone: 
Entacapone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1312 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    1312 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1312 (COMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     1312 (COMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   1312 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 271 aa AA seqDB search
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggccccgcctctgctgttggcagctgtgttgctgggcctggtgctgctggtg
gtgctgctgctgcttctgaggcactggggctggggcctgtgccttatcggctggaacgag
ttcatcctgcagcccatccacaacctgctcatgggtgacaccaaggagcagcgcatcctg
aaccacgtgctgcagcatgcggagcccgggaacgcacagagcgtgctggaggccattgac
acctactgcgagcagaaggagtgggccatgaacgtgggcgacaagaaaggcaagatcgtg
gacgccgtgattcaggagcaccagccctccgtgctgctggagctgggggcctactgtggc
tactcagctgtgcgcatggcccgcctgctgtcaccaggggcgaggctcatcaccatcgag
atcaaccccgactgtgccgccatcacccagcggatggtggatttcgctggcgtgaaggac
aaggtcacccttgtggttggagcgtcccaggacatcatcccccagctgaagaagaagtat
gatgtggacacactggacatggtcttcctcgaccactggaaggaccggtacctgccggac
acgcttctcttggaggaatgtggcctgctgcggaaggggacagtgctactggctgacaac
gtgatctgcccaggtgcgccagacttcctagcacacgtgcgcgggagcagctgctttgag
tgcacacactaccaatcgttcctggaatacagggaggtggtggacggcctggagaaggcc
atctacaagggcccaggcagcgaagcagggccctga

DBGET integrated database retrieval system