KEGG   Homo sapiens (human): 131873Help
Entry
131873            CDS       T01001                                 

Gene name
COL6A6
Definition
collagen, type VI, alpha 6
Orthology
K06238  
collagen, type VI, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22.1
AA seq 2263 aa AA seqDB search
MMLLILFLVIICSHISVNQDSGPEYADVVFLVDSSDRLGSKSFPFVKMFITKMISSLPIE
ADKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFS
APANGRDKKQFPPILVVLASSESEDNVEEASKALRKDGVKIISVGVQKASEENLKAMATS
QFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEACQGPSMADVVFLLDMSING
SEENFDYLKGFLEESVSALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLS
PRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGV
TIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSE
RTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQY
ADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCH
LVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALK
DIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQ
IGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP
NIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN
FDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKAD
VGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFT
EARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMA
GSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFKKMK
EFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIG
AALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQAAEALRHRGIDIYSVGIGDV
DDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTTAGESNCFVDVVVGFDVSTQEKG
QTLLEGQPWMETYLQDILRAISSLNGVSCEVGTETQVSVAFQVTNAMEKYSPKFEIYSEN
ILNSLKDITVKGPSLLNANLLDSLWDTFQNKSAARGKVVLLFSDGLDDDVEKLEQKSDEL
RKEGLNALITVALDGPADSSDLADLPYIEFGKGFEYRTQLSIGMRELGSRLSKQLVNVAE
RTCCCLFCKCIGGDGTMGDPGPPGKRGPPGFKGSEGYLGEEGIAGERGAPGPVGEQGTKG
CYGTKGPKGNRGLNGQEGEVGENGIDGLNGEQGDNGLPGRKGEKGDEGSQGSPGKRGTPG
DRGAKGLRGDPGAPGVDSSIEGPTGLKGERGRQGRRGWPGPPGTPGSRRKTAAHGRRGHT
GPQGTAGIPGPDGLEGSLGLKGPQGPRGEAGVKGEKGGVGSKGPQGPPGPGGEAGNQGRL
GSQGNKGEPGDLGEKGAVGFPGPRGLQGNDGSPGYGSVGRKGAKGQEGFPGESGPKGEIG
DPGGPGETGLKGARGKMISAGLPGEMGSPGEPGPPGRKGVKGAKGLASFSTCELIQYVRD
RSPGRHGKPECPVHPTELVFALDHSRDVTEQEFERMKEMMAFLVRDIKVRENSCPVGAHI
AILSYNSHARHLVRFSDAYKKSQLLREIETIPYERSSASREIGRAMRFISRNVFKRTLPG
AHTRKIATFFSSGQSADAHSITTAAMEFGALEIIPVVITFSNVPSVRRAFAIDDTGTFQV
IVVPSGADYIPALERLQRCTFCYDVCKPDASCDQARPPPVQSYMDAAFLLDASRNMGSAE
FEDIRAFLGALLDHFEITPEPETSVTGDRVALLSHAPPDFLPNTQKSPVRAEFNLTTYRS
KRLMKRHVHESVKQLNGDAFIGHALQWTLDNVFLSTPNLRRNKVIFVISAGETSHLDGEI
LKKESLRAKCQGYALFVFSLGPIWDDKELEDLASHPLDHHLVQLGRIHKPDHSYGVKFVK
SFINSIRRAINKYPPINLKIKCNRLNSIDPKQPPRPFRSFVPGPLKATLKEDVLQKAKFF
QDKKYLSRVARSGRDDAIQNFMRSTSHTFKNGRMIESAPKQHD
NT seq 6792 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgctaattttgttcctcgtgataatttgttcccatatttctgtgaaccaagat
tccggccctgagtatgcagatgttgtgtttttggtggacagctctgatcgcctgggatcc
aagtccttcccatttgtgaaaatgttcatcaccaaaatgatcagcagtctccccatagag
gccgacaaataccgtgtggccctggcccagtacagtgataaacttcacagtgaattccac
ctgagcaccttcaaaggcaggagccccatgctgaaccacctaaggaagaactttggattc
attggcgggtccctgcagataggaaaggctcttcaggaggctcacaggacttatttctct
gcacccgcaaatgggagagacaagaaacagtttcccccaattctagtggtcctggcttca
tctgagtctgaggataatgtggaagaggcatcaaaggccctgcggaaagacggagtgaaa
atcatctctgtaggggtgcagaaagcttctgaggaaaacctgaaggccatggccacgtct
cagtttcatttcaaccttcggacagtcagagacctcagcatgttttcccaaaacatgaca
cacatcatcaaggatgtaataaagtacaaggagggagcagttgatgacatctttgtagaa
gcttgccaaggcccttctatggccgatgttgtgttcctattggatatgtcaatcaatgga
agtgaggagaactttgactatcttaaaggattcttggaagaaagtgtatctgcccttgac
ataaaggaaaattgcatgagggttggccttgtggcctatagcaatgagacaaaagtgata
aattcactgagcatgggcataaataagtcagaggttctccagcatatacagaacctttct
ccccgaactgggaaggcctatactggagctgccatcaaaaagctcaggaaggaagttttt
agtgcacggaatggcagtcggaagaatcagggggtgccccagattgccgtgctggtgacc
caccgagattcagaagacaacgtgacaaaagcagctgttaacctccgacgggagggtgtg
accatcttcaccctgggcatagagggcgccagcgacacccagttggaaaagatagcatcc
caccctgctgagcagtatgtctccaaactgaagaccttcgctgacctggctgctcacaac
cagacatttctgaagaagctgcggaaccaaataacacacacagtctctgtcttttcagag
aggactgaaacgctcaaatctggttgtgtggacactgaggaagcagacatctatctgctt
atcgatggctcagggagcacccaggccacagatttccatgaaatgaagacgttcctgtca
gaggtggtagggatgttcaacattgctccccataaggtgcgggttggggccgttcagtat
gctgacagctgggacttggaatttgagatcaataaatactccaacaagcaggatttggga
aaggccattgagaatatcaggcagatgggtgggaatacaaacacaggcgcagcactgaat
ttcacactgagtctgttgcaaaaagcaaagaagcagcgaggaaacaaagttccatgccac
cttgttgtcctgacaaatggcatgtccaaggatagcatcttggagcctgcaaacagactg
agagaagagcacatccgagtttatgctatcgggatcaaggaggccaaccaaacacagctg
agagaaattgcaggagaggaaaagagagtgtattacgtgcatgactttgatgcattgaaa
gacataagaaaccaagttgttcaagaaatctgtactgaagaagcttgcaaagagatgaaa
gctgacatcatgtttctggtggacagttctggaagtataggacctgaaaacttcagcaaa
atgaaaacatttatgaaaaacctggtgagcaagtctcagattggaccagatcgggtgcaa
attggtgtagtccagttcagcgacatcaataaggaagagtttcagctcaacagattcatg
tcccaaagcgacatttcaaatgcaatagaccaaatggctcacattggacaaaccaccctg
actggtagtgccctgagctttgtgtctcagtacttcagccccaccaagggcgcccggccc
aacatcagaaagtttctcatcctcatcacggatggtgaagctcaggacatagtaaaggaa
ccagcagtagtgcttcggcaagaaggtgtaatcatctattctgtgggagtgtttggctcc
aatgtcacccagcttgaggagatcagtgggaggcccgagatggttttttatgttgagaat
tttgacattctgcagcgcattgaagatgatcttgtttttggaatatgcagcccccgtgaa
gaatgcaagcggattgaagttttagacgttgtgtttgtcattgatagctctggcagtatt
gactatgatgagtataatatcatgaaggattttatgattggcttagtgaaaaaagctgat
gtgggcaagaatcaggtccggtttggggctctgaagtatgctgatgacccagaggtgctg
ttttatctggatgactttggcacaaaactggaggtaatttcagtgctccagaatgaccaa
gccatgggtggcagtacttatactgctgaggcactgggcttctcagaccacatgttcact
gaagcccggggcagccgcctgaacaagggggtcccccaagtcctcattgtgatcaccgat
ggggaatcccatgatgctgataaactcaatgccacggcaaaggccttgcgggacaaaggc
attcttgtcctggctgtggggattgatggtgccaatcccgtggagctgttagccatggca
ggatcaagcgacaagtacttcttcgtggagacttttggaggtctgaagggaatattttca
gatgtgacagccagtgtctgcaactcttcaaaagtagattgtgaaattgacaaagtagat
cttgttttccttatggatggttcaactagcattcagccaaatgacttcaagaaaatgaag
gaatttctggcatctgttgttcaagactttgatgtcagcctcaacagagtgcgaatagga
gcggcccagtttagcgatacctatcacccggagtttccactgggaactttcataggtgaa
aaagagatatcatttcagattgaaaacatcaagcagatctttggaaacacacacatcggt
gctgcactcagggaggtggaacattacttcaggccagacatgggcagcaggataaataca
ggtaccccacaggtgctgctggtccttacagatggccagtcccaagacgaggtggcccag
gccgcggaagccctgagacacagaggtatcgacatctactccgtgggcattggggatgtg
gatgaccagcagctcattcagatcaccgggactgcagagaaaaaactgacagtgcacaac
ttcgatgaactgaagaaggtcaataaaaggatcgttcgcaacatctgtaccacagcgggt
gaaagcaactgtttcgtggatgttgtggtgggatttgatgtctcaactcaggagaaaggg
cagactttgcttgaaggtcagccttggatggaaacctaccttcaagacatcttacgtgcc
atcagctccctcaatggagtaagctgtgaggtgggcacagagactcaggtcagtgtggct
tttcaagtgaccaatgccatggaaaaatattctcccaagtttgagatctacagtgaaaac
atactgaatagcttgaaggatataacagttaaaggaccatctcttctcaatgcaaacctc
ttggattctctatgggatacatttcagaataaatcagctgctcgaggaaaggtggtcctt
ttattttcagatggattggatgatgatgttgagaaacttgaacaaaaatctgatgaactt
agaaaagaaggcctgaatgccctcataactgttgctctggatggacctgctgattcaagt
gacttggctgatcttccctatattgaatttgggaaaggatttgagtacaggacacagctc
tctattggcatgagagaacttggaagccggctgtcaaagcagctggtcaatgttgctgaa
aggacatgctgctgtttgttctgcaagtgcattggaggagatggcacaatgggagatcct
ggaccaccagggaaaaggggacctccaggttttaaaggcagtgaaggctacctgggagag
gagggaatcgctggagaaagaggagcccctggaccagtgggagagcaaggtactaaggga
tgctatggcaccaaaggtcctaagggaaacagaggactaaatggacaggagggagaagtt
ggggaaaatggaattgacggattaaacggagaacagggtgataatggtcttcctggaaga
aaaggagaaaagggagatgagggatctcagggaagcccagggaagagagggactcctggt
gaccgtggagcaaagggcctgcgaggggatcccggagctcctggagttgacagtagcata
gaaggacccacaggcttgaaaggagaacgtggaagacaaggcagaagaggctggccaggc
ccccccgggacaccaggctccagaagaaagacagcagctcatggcagaaggggacataca
ggcccacagggaacagcaggcatcccaggaccagatggacttgaaggctccctgggactt
aagggccctcagggcccaagaggagaggctggtgtgaaaggagaaaaaggaggtgtggga
agtaaaggtccccaggggcctccaggacccggaggagaggcagggaatcaaggccgtttg
ggaagccaaggaaataaaggagaacctggagatctgggagaaaaaggagctgttggcttt
cctggtcctcgtggcttgcagggcaatgatggcagtccaggttatggtagtgtcggacgc
aagggagcaaagggacaagaaggattccctggagaaagtggacctaagggtgagattggg
gaccctggtggtccaggagagactgggctgaagggagctagaggcaaaatgatatctgct
gggcttccaggagagatgggatcccctggggaaccaggacctcctggacgtaagggtgtg
aaaggagccaaaggcttggcttcattttctacatgtgagctcattcagtatgtgcgagac
cgcagtcctggcaggcatggaaaaccggaatgcccagtgcacccaaccgagttggtgttt
gccctggaccactcccgggatgtcactgagcaggaatttgagcggatgaaggagatgatg
gctttcctggtgagagacattaaggtccgggagaacagctgccccgtgggagcgcacatc
gccatcctctcctataactcccacgccaggcaccttgtgcgcttctcagacgcctacaag
aagagtcaacttctcagagaaattgaaactattccttatgagagatcctctgccagcagg
gagattggcagagcaatgcggtttatttccaggaatgtcttcaagcggacgcttccgggg
gcacacacgagaaaaatcgccacatttttcagcagcggtcagtccgcggatgcccactcc
atcaccacggctgccatggagttcggcgcgcttgaaatcattcccgtggtgatcactttc
agcaacgtgccctcggtcaggcgcgcatttgcgattgacgacactggcacatttcaagta
atagtggttccctccggggccgactacataccagcattagagagactccagcggtgcact
ttctgctatgatgtgtgcaagccagatgcttcttgtgaccaagccagaccaccccctgtg
cagtcttacatggatgctgctttccttctggatgcctcccggaacatgggaagtgctgaa
tttgaagacataagagccttccttggagcactattagatcactttgaaatcaccccagag
ccggagacttctgtcactggagaccgggtggccctattgagccatgctccccccgacttc
ctacccaacactcagaagagtccagttagagctgagttcaatcttaccacctacagaagt
aagcgcctcatgaagaggcatgtgcacgagtcagttaaacaactaaatggagatgctttt
attggtcatgccttacagtggactctggacaatgtatttttaagtacacccaatctgaga
agaaacaaagtcatatttgtgatatctgctggggaaaccagccacttagatggggaaatc
ttaaagaaggaatccttgcgagccaaatgtcagggatatgccttatttgtgttttccctt
ggccctatttgggatgacaaggaactggaggatctcgccagccaccctttggatcaccac
ctggtccagcttggccgaattcataaacctgaccacagttatggtgtgaagtttgtgaag
tcctttataaactcaatcaggcgtgcaatcaacaaatatccaccaataaacttaaaaata
aagtgcaacagacttaactctatagatccaaagcagcccccacgaccattccgaagcttt
gttcctggaccacttaaagctaccctcaaagaagatgtattacagaaggcaaaattcttt
caagataaaaaatatctttcaagagtagcaagaagtggcagagatgatgctattcaaaat
tttatgagaagcacctcccatacctttaagaatggaaggatgatagaaagtgctcccaaa
caacatgattaa

DBGET integrated database retrieval system