KEGG   Homo sapiens (human): 135Help
Entry
135               CDS       T01001                                 

Gene name
ADORA2A, A2aR, ADORA2, RDC8
Definition
adenosine A2a receptor
Orthology
K04266  
adenosine receptor A2a
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Parkinson's disease
Alcoholism
Drug target
Adenosine: 
Regadenoson: 
Caffeine: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    135 (ADORA2A)
   04020 Calcium signaling pathway
    135 (ADORA2A)
   04024 cAMP signaling pathway
    135 (ADORA2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    135 (ADORA2A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    135 (ADORA2A)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    135 (ADORA2A)
  Substance dependence
   05034 Alcoholism
    135 (ADORA2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    135 (ADORA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 412 aa AA seqDB search
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatgggctcctcggtgtacatcacggtggagctggccattgctgtgctggcc
atcctgggcaatgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagaacgtc
accaactactttgtggtgtcactggcggcggccgacatcgcagtgggtgtgctcgccatc
ccctttgccatcaccatcagcaccgggttctgcgctgcctgccacggctgcctcttcatt
gcctgcttcgtcctggtcctcacgcagagctccatcttcagtctcctggccatcgccatt
gaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcacgagg
gctaagggcatcattgccatctgctgggtgctgtcgtttgccatcggcctgactcccatg
ctaggttggaacaactgcggtcagccaaaggagggcaagaaccactcccagggctgcggg
gagggccaagtggcctgtctctttgaggatgtggtccccatgaactacatggtgtacttc
aacttctttgcctgtgtgctggtgcccctgctgctcatgctgggtgtctatttgcggatc
ttcctggcggcgcgacgacagctgaagcagatggagagccagcctctgccgggggagcgg
gcacggtccacactgcagaaggaggtccatgctgccaagtcactggccatcattgtgggg
ctctttgccctctgctggctgcccctacacatcatcaactgcttcactttcttctgcccc
gactgcagccacgcccctctctggctcatgtacctggccatcgtcctctcccacaccaat
tcggttgtgaatcccttcatctacgcctaccgtatccgcgagttccgccagaccttccgc
aagatcattcgcagccacgtcctgaggcagcaagaacctttcaaggcagctggcaccagt
gcccgggtcttggcagctcatggcagtgacggagagcaggtcagcctccgtctcaacggc
cacccgccaggagtgtgggccaacggcagtgctccccaccctgagcggaggcccaatggc
tatgccctggggctggtgagtggagggagtgcccaagagtcccaggggaacacgggcctc
ccagacgtggagctccttagccatgagctcaagggagtgtgcccagagccccctggccta
gatgaccccctggcccaggatggagcaggagtgtcctga

DBGET integrated database retrieval system