KEGG   Homo sapiens (human): 1357Help
Entry
1357              CDS       T01001                                 

Gene name
CPA1, CPA
Definition
carboxypeptidase A1 (pancreatic) (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q32
AA seq 419 aa AA seqDB search
MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPG
SPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYA
TYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTR
SHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIK
AFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQA
SGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggttgctggtgttgagtgtcctgttgggggctgtctttggcaaggaggacttt
gtggggcatcaggtgctccgaatctctgtagccgatgaggcccaggtacagaaggtgaag
gagctggaggacctggagcacctgcagctggacttctggcgggggcctgcccaccctggc
tcccccatcgacgtccgagtgcccttccccagcatccaggcggtcaagatctttctggag
tcccacggcatcagctatgagaccatgatcgaggacgtgcagtcgctgctggacgaggag
caggagcagatgttcgccttccggtcccgggcgcgctccaccgacacttttaactacgcc
acctaccacaccctggaggagatctatgacttcctggacctgctggtggcggagaacccg
caccttgtcagcaagatccagattggcaacacctatgaagggcgtcccatttacgtgctg
aagttcagcacggggggcagtaagcgtccagccatctggatcgacacgggcatccattcc
cgggagtgggtcacccaggccagtggggtctggtttgcaaagaagatcactcaagactac
gggcaggatgcagctttcaccgccattctcgacaccttggacatcttcctggagatcgtc
accaaccctgatggctttgccttcacgcacagcacgaatcgcatgtggcgcaagactcgg
tcccacacagcaggctccctctgtattggcgtggaccccaacaggaactgggacgctggc
tttgggttgtccggagccagcagtaacccctgctcggagacttaccacggcaagtttgcc
aattccgaagtggaggtcaagtccattgtagactttgtgaaggaccatgggaacatcaag
gccttcatctccatccacagctactcccagctcctcatgtatccctatggctacaaaaca
gaaccagtccctgaccaggatgagctggatcagctttccaaggctgctgtgacagccctg
gcctctctctacgggaccaagttcaactatggcagcatcatcaaggcaatttatcaagcc
agtggaagcactattgactggacctacagccagggcatcaagtactccttcaccttcgag
ctccgggacactgggcgctatggcttcctgctgccagcctcccagatcatccccacagcc
aaggagacgtggctggcgcttctgaccatcatggagcacaccctgaatcacccctactga

DBGET integrated database retrieval system