KEGG   Homo sapiens (human): 1359Help
Entry
1359              CDS       T01001                                 

Gene name
CPA3, MC-CPA
Definition
carboxypeptidase A3 (mast cell) (EC:3.4.17.1)
Orthology
K08780  
carboxypeptidase A3 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 417 aa AA seqDB search
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcatcctgcctgtgggtttgattgctaccactcttgcaattgctcctgtccgc
tttgacagggagaaggtgttccgcgtgaagccccaggatgaaaaacaagcagacatcata
aaggacttggccaaaaccaatgagcttgacttctggtatccaggtgccacccaccacgta
gctgctaatatgatggtggatttccgagttagtgagaaggaatcccaagccatccagtct
gccttggatcaaaataaaatgcactatgaaatcttgattcatgatctacaagaagagatt
gagaaacagtttgatgttaaagaagatatcccaggcaggcacagctacgcaaaatacaat
aattgggaaaagattgtggcttggactgaaaagatgatggataagtatcctgaaatggtc
tctcgtattaaaattggatctactgttgaagataatccactatatgttctgaagattggg
gaaaagaatgaaagaagaaaggctatttttacggattgtggcattcacgcacgagaatgg
gtctccccagcattctgccagtggtttgtctatcaggcaaccaaaacttatgggagaaac
aaaattatgaccaaactcttggaccgaatgaatttttacattcttcctgtgttcaatgtt
gatggatatatttggtcatggacaaagaaccgcatgtggagaaaaaatcgttccaagaac
caaaactccaaatgcatcggcactgacctcaacaggaattttaatgcttcatggaactcc
attcctaacaccaatgacccatgtgcagataactatcggggctctgcaccagagtccgag
aaagagacgaaagctgtcactaatttcattagaagccacctgaatgaaatcaaggtttac
atcaccttccattcctactcccagatgctattgtttccctatggatatacatcaaaactg
ccacctaaccatgaggacttggccaaagttgcaaagattggcactgatgttctatcaact
cgatatgaaacccgctacatctatggcccaatagaatcaacaatttacccgatatcaggt
tcttctttagactgggcttatgacctgggcatcaaacacacatttgcctttgagctccga
gataaaggcaaatttggttttctccttccagaatcccggataaagccaacgtgcagagag
accatgctagctgtcaaatttattgccaagtatatcctcaagcatacttcctaa

DBGET integrated database retrieval system