KEGG   Homo sapiens (human): 1359Help
Entry
1359              CDS       T01001                                 

Gene name
CPA3, MC-CPA
Definition
carboxypeptidase A3 (mast cell) (EC:3.4.17.1)
Orthology
K08780  
carboxypeptidase A3 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    1359 (CPA3)
  Digestive system
   04972 Pancreatic secretion
    1359 (CPA3)
   04974 Protein digestion and absorption
    1359 (CPA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     1359 (CPA3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1359 (CPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 417 aa AA seqDB search
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcatcctgcctgtgggtttgattgctaccactcttgcaattgctcctgtccgc
tttgacagggagaaggtgttccgcgtgaagccccaggatgaaaaacaagcagacatcata
aaggacttggccaaaaccaatgagcttgacttctggtatccaggtgccacccaccacgta
gctgctaatatgatggtggatttccgagttagtgagaaggaatcccaagccatccagtct
gccttggatcaaaataaaatgcactatgaaatcttgattcatgatctacaagaagagatt
gagaaacagtttgatgttaaagaagatatcccaggcaggcacagctacgcaaaatacaat
aattgggaaaagattgtggcttggactgaaaagatgatggataagtatcctgaaatggtc
tctcgtattaaaattggatctactgttgaagataatccactatatgttctgaagattggg
gaaaagaatgaaagaagaaaggctatttttacggattgtggcattcacgcacgagaatgg
gtctccccagcattctgccagtggtttgtctatcaggcaaccaaaacttatgggagaaac
aaaattatgaccaaactcttggaccgaatgaatttttacattcttcctgtgttcaatgtt
gatggatatatttggtcatggacaaagaaccgcatgtggagaaaaaatcgttccaagaac
caaaactccaaatgcatcggcactgacctcaacaggaattttaatgcttcatggaactcc
attcctaacaccaatgacccatgtgcagataactatcggggctctgcaccagagtccgag
aaagagacgaaagctgtcactaatttcattagaagccacctgaatgaaatcaaggtttac
atcaccttccattcctactcccagatgctattgtttccctatggatatacatcaaaactg
ccacctaaccatgaggacttggccaaagttgcaaagattggcactgatgttctatcaact
cgatatgaaacccgctacatctatggcccaatagaatcaacaatttacccgatatcaggt
tcttctttagactgggcttatgacctgggcatcaaacacacatttgcctttgagctccga
gataaaggcaaatttggttttctccttccagaatcccggataaagccaacgtgcagagag
accatgctagctgtcaaatttattgccaagtatatcctcaagcatacttcctaa

DBGET integrated database retrieval system