KEGG   Homo sapiens (human): 1359Help
Entry
1359              CDS       T01001                                 

Gene name
CPA3, MC-CPA
Definition
(RefSeq) carboxypeptidase A3
  KO
K08780  carboxypeptidase A3 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    1359 (CPA3)
  Digestive system
   04972 Pancreatic secretion
    1359 (CPA3)
   04974 Protein digestion and absorption
    1359 (CPA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     1359 (CPA3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1359 (CPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 GATase1_like
Motif
Other DBs
NCBI-GeneID: 1359
NCBI-ProteinID: NP_001861
OMIM: 114851
HGNC: 2298
Ensembl: ENSG00000163751
Vega: OTTHUMG00000159526
Pharos: P15088(Tchem)
UniProt: P15088
Position
3q24
AA seq 417 aa AA seqDB search
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcatcctgcctgtgggtttgattgctaccactcttgcaattgctcctgtccgc
tttgacagggagaaggtgttccgcgtgaagccccaggatgaaaaacaagcagacatcata
aaggacttggccaaaaccaatgagcttgacttctggtatccaggtgccacccaccacgta
gctgctaatatgatggtggatttccgagttagtgagaaggaatcccaagccatccagtct
gccttggatcaaaataaaatgcactatgaaatcttgattcatgatctacaagaagagatt
gagaaacagtttgatgttaaagaagatatcccaggcaggcacagctacgcaaaatacaat
aattgggaaaagattgtggcttggactgaaaagatgatggataagtatcctgaaatggtc
tctcgtattaaaattggatctactgttgaagataatccactatatgttctgaagattggg
gaaaagaatgaaagaagaaaggctatttttacggattgtggcattcacgcacgagaatgg
gtctccccagcattctgccagtggtttgtctatcaggcaaccaaaacttatgggagaaac
aaaattatgaccaaactcttggaccgaatgaatttttacattcttcctgtgttcaatgtt
gatggatatatttggtcatggacaaagaaccgcatgtggagaaaaaatcgttccaagaac
caaaactccaaatgcatcggcactgacctcaacaggaattttaatgcttcatggaactcc
attcctaacaccaatgacccatgtgcagataactatcggggctctgcaccagagtccgag
aaagagacgaaagctgtcactaatttcattagaagccacctgaatgaaatcaaggtttac
atcaccttccattcctactcccagatgctattgtttccctatggatatacatcaaaactg
ccacctaaccatgaggacttggccaaagttgcaaagattggcactgatgttctatcaact
cgatatgaaacccgctacatctatggcccaatagaatcaacaatttacccgatatcaggt
tcttctttagactgggcttatgacctgggcatcaaacacacatttgcctttgagctccga
gataaaggcaaatttggttttctccttccagaatcccggataaagccaacgtgcagagag
accatgctagctgtcaaatttattgccaagtatatcctcaagcatacttcctaa

DBGET integrated database retrieval system