KEGG   Homo sapiens (human): 1360Help
Entry
1360              CDS       T01001                                 

Gene name
CPB1, CPB, PASP, PCPB
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1360 (CPB1)
   04974 Protein digestion and absorption
    1360 (CPB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     1360 (CPB1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1360 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q24
AA seq 417 aa AA seqDB search
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactcttggttctggtgactgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtgttaacgttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagattgacttctggaagccagattctgtcacacaa
atcaaacctcacagtacagttgacttccgtgttaaagcagaagatactgtcactgtggag
aatgttctaaagcagaatgaactacaatacaaggtactgataagcaacctgagaaatgtg
gtggaggctcagtttgatagccgggttcgtgcaacaggacacagttatgagaagtacaac
aagtgggaaacgatagaggcttggactcaacaagtcgccactgagaatccagccctcatc
tctcgcagtgttatcggaaccacatttgagggacgcgctatttacctcctgaaggttggc
aaagctggacaaaataagcctgccattttcatggactgtggtttccatgccagagagtgg
atttctcctgcattctgccagtggtttgtaagagaggctgttcgtacctatggacgtgag
atccaagtgacagagcttctcgacaagttagacttttatgtcctgcctgtgctcaatatt
gatggctacatctacacctggaccaagagccgattttggagaaagactcgctccacccat
actggatctagctgcattggcacagaccccaacagaaattttgatgctggttggtgtgaa
attggagcctctcgaaacccctgtgatgaaacttactgtggacctgccgcagagtctgaa
aaggagaccaaggccctggctgatttcatccgcaacaaactctcttccatcaaggcatat
ctgacaatccactcgtactcccaaatgatgatctacccttactcatatgcttacaaactc
ggtgagaacaatgctgagttgaatgccctggctaaagctactgtgaaagaacttgcctca
ctgcacggcaccaagtacacatatggcccgggagctacaacaatctatcctgctgctggg
ggctctgacgactgggcttatgaccaaggaatcagatattccttcacctttgaacttcga
gatacaggcagatatggctttctccttccagaatcccagatccgggctacctgcgaggag
accttcctggcaatcaagtatgttgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system