KEGG   Homo sapiens (human): 1360Help
Entry
1360              CDS       T01001                                 

Gene name
CPB1, CPB, PASP, PCPB
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q24
AA seq 417 aa AA seqDB search
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactcttggttctggtgactgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtgttaacgttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagattgacttctggaagccagattctgtcacacaa
atcaaacctcacagtacagttgacttccgtgttaaagcagaagatactgtcactgtggag
aatgttctaaagcagaatgaactacaatacaaggtactgataagcaacctgagaaatgtg
gtggaggctcagtttgatagccgggttcgtgcaacaggacacagttatgagaagtacaac
aagtgggaaacgatagaggcttggactcaacaagtcgccactgagaatccagccctcatc
tctcgcagtgttatcggaaccacatttgagggacgcgctatttacctcctgaaggttggc
aaagctggacaaaataagcctgccattttcatggactgtggtttccatgccagagagtgg
atttctcctgcattctgccagtggtttgtaagagaggctgttcgtacctatggacgtgag
atccaagtgacagagcttctcgacaagttagacttttatgtcctgcctgtgctcaatatt
gatggctacatctacacctggaccaagagccgattttggagaaagactcgctccacccat
actggatctagctgcattggcacagaccccaacagaaattttgatgctggttggtgtgaa
attggagcctctcgaaacccctgtgatgaaacttactgtggacctgccgcagagtctgaa
aaggagaccaaggccctggctgatttcatccgcaacaaactctcttccatcaaggcatat
ctgacaatccactcgtactcccaaatgatgatctacccttactcatatgcttacaaactc
ggtgagaacaatgctgagttgaatgccctggctaaagctactgtgaaagaacttgcctca
ctgcacggcaccaagtacacatatggcccgggagctacaacaatctatcctgctgctggg
ggctctgacgactgggcttatgaccaaggaatcagatattccttcacctttgaacttcga
gatacaggcagatatggctttctccttccagaatcccagatccgggctacctgcgaggag
accttcctggcaatcaagtatgttgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system