KEGG   Homo sapiens (human): 1360Help
Entry
1360              CDS       T01001                                 

Gene name
CPB1, CPB, PASP, PCPB
Definition
(RefSeq) carboxypeptidase B1
  KO
K01291  carboxypeptidase B [EC:3.4.17.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1360 (CPB1)
   04974 Protein digestion and absorption
    1360 (CPB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     1360 (CPB1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1360 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 Intimin_C GATase1_like
Motif
Other DBs
NCBI-GeneID: 1360
NCBI-ProteinID: NP_001862
OMIM: 114852
HGNC: 2299
Ensembl: ENSG00000153002
Vega: OTTHUMG00000159520
Pharos: P15086(Tchem)
UniProt: P15086
Structure
PDB: 

Jmol
Position
3q24
AA seq 417 aa AA seqDB search
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactcttggttctggtgactgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtgttaacgttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagattgacttctggaagccagattctgtcacacaa
atcaaacctcacagtacagttgacttccgtgttaaagcagaagatactgtcactgtggag
aatgttctaaagcagaatgaactacaatacaaggtactgataagcaacctgagaaatgtg
gtggaggctcagtttgatagccgggttcgtgcaacaggacacagttatgagaagtacaac
aagtgggaaacgatagaggcttggactcaacaagtcgccactgagaatccagccctcatc
tctcgcagtgttatcggaaccacatttgagggacgcgctatttacctcctgaaggttggc
aaagctggacaaaataagcctgccattttcatggactgtggtttccatgccagagagtgg
atttctcctgcattctgccagtggtttgtaagagaggctgttcgtacctatggacgtgag
atccaagtgacagagcttctcgacaagttagacttttatgtcctgcctgtgctcaatatt
gatggctacatctacacctggaccaagagccgattttggagaaagactcgctccacccat
actggatctagctgcattggcacagaccccaacagaaattttgatgctggttggtgtgaa
attggagcctctcgaaacccctgtgatgaaacttactgtggacctgccgcagagtctgaa
aaggagaccaaggccctggctgatttcatccgcaacaaactctcttccatcaaggcatat
ctgacaatccactcgtactcccaaatgatgatctacccttactcatatgcttacaaactc
ggtgagaacaatgctgagttgaatgccctggctaaagctactgtgaaagaacttgcctca
ctgcacggcaccaagtacacatatggcccgggagctacaacaatctatcctgctgctggg
ggctctgacgactgggcttatgaccaaggaatcagatattccttcacctttgaacttcga
gatacaggcagatatggctttctccttccagaatcccagatccgggctacctgcgaggag
accttcctggcaatcaagtatgttgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system