KEGG   Homo sapiens (human): 1361Help
Entry
1361              CDS       T01001                                 

Gene name
CPB2, CPU, PCPB, TAFI
Definition
carboxypeptidase B2 (plasma) (EC:3.4.17.20)
Orthology
K01300  
carboxypeptidase B2 [EC:3.4.17.20]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.11
AA seq 386 aa AA seqDB search
MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD
LIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYY
EQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGI
HAREWISPAFCLWFIGHNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSET
YCGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVA
SEAVRAIEKISKNTRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLP
ERYIKPTCREAFAAVSKIAWHVIRNV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttgcagccttgcagtccttgtacccattgttctcttctgtgagcagcatgtc
ttcgcgtttcagagtggccaagttctagctgctcttcctagaacctctaggcaagttcaa
gttctacagaatcttactacaacatatgagattgttctctggcagccggtaacagctgac
cttattgtgaagaaaaaacaagtccatttttttgtaaatgcatctgatgtcgacaatgtg
aaagcccatttaaatgtgagcggaattccatgcagtgtcttgctggcagatgtggaagat
cttattcaacagcagatttccaacgacacagtcagcccccgagcctccgcatcgtactat
gaacagtatcactcactaaatgaaatctattcttggatagaatttataactgagaggcat
cctgatatgcttacaaaaatccacattggatcctcatttgagaagtacccactctatgtt
ttaaaggtttctggaaaagaacaagcagccaaaaatgccatatggattgactgtggaatc
catgccagagaatggatctctcctgctttctgcttgtggttcataggccataatcgaatg
tggagaaagaaccgttctttctatgcgaacaatcattgcatcggaacagacctgaatagg
aactttgcttccaaacactggtgtgaggaaggtgcatccagttcctcatgctcggaaacc
tactgtggactttatcctgagtcagaaccagaagtgaaggcagtggctagtttcttgaga
agaaatatcaaccagattaaagcatacatcagcatgcattcatactcccagcatatagtg
tttccatattcctatacacgaagtaaaagcaaagaccatgaggaactgtctctagtagcc
agtgaagcagttcgtgctattgagaaaattagtaaaaataccaggtatacacatggccat
ggctcagaaaccttatacctagctcctggaggtggggacgattggatctatgatttgggc
atcaaatattcgtttacaattgaacttcgagatacgggcacatacggattcttgctgccg
gagcgttacatcaaacccacctgtagagaagcttttgccgctgtctctaaaatagcttgg
catgtcattaggaatgtttaa

DBGET integrated database retrieval system