KEGG   Homo sapiens (human): 1375Help
Entry
1375              CDS       T01001                                 

Gene name
CPT1B, CPT1-M, CPT1M, CPTI, CPTI-M, M-CPT1, MCCPT1, MCPT1
Definition
carnitine palmitoyltransferase 1B (muscle) (EC:2.3.1.21)
Orthology
K08765  
carnitine O-palmitoyltransferase 1 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
Adipocytokine signaling pathway
Drug target
Perhexiline: 
Other: 
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.33
AA seq 738 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAYLESVRPLLDDEEYYRMELLAKEFQDK
TAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARL
GNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRH
VAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQ
ARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFD
KSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAP
PTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIAL
QLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQ
KAAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQI
RMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNHI
RKALLDIADLFQVPKAYS
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcaccaggccgtggccttccagttcacggtgaccccagacggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcatcatggcaacagtgggttcctccttctgcaacgtggacatctcc
ttggggctggtcagttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctgctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggcttacctagagtctgtgcgcccc
ttgttggatgatgaggaatattaccgcatggagttgctggccaaagaattccaggacaag
actgcccccaggctgcagaaatacctggtgctcaagtcatggtgggcaagtaactatgtg
agtgactggtgggaagagtacatctaccttcgaggcaggagccctctcatggtgaacagc
aactattatgtcatggaccttgtgctcatcaagaatacagacgtgcaggcagcccgcctg
ggaaacatcatccacgccatgatcatgtatcgccgtaaactggaccgtgaagaaatcaag
cctgtgatggcactgggcatagtgcctatgtgctcctaccagatggagaggatgttcaac
accactcggatcccgggcaaggacacagatgtgctacagcacctctcagacagccggcac
gtggctgtctaccacaagggacgcttcttcaagctgtggctctatgagggcgcccgtctg
ctcaagcctcaggatctggagatgcagttccagaggatcctggacgacccctccccacct
cagcctggggaggagaagctggcagccctcactgcaggaggaagggtggagtgggcgcag
gcacgccaggccttctttagctctggaaagaataaggctgccttggaggccatcgagcgt
gccgctttcttcgtggccctggatgaggaatcctactcctatgaccccgaagatgaggcc
agcctcagcctctatggcaaggccctgctacatggcaactgctacaacaggtggtttgac
aaatccttcactctcatttccttcaagaatggccagttgggtctcaatgcagagcatgcg
tgggcagatgctcccatcattgggcacctctgggagtttgtcctgggcacagacagcttc
cacctgggctacacggagaccgggcactgcctgggcaaaccgaaccctgcgctcgcacct
cctacacggctgcagtgggacattccaaaacagtgccaggcggtcatcgagagttcctac
caggtggccaaggcgttggcagacgacgtggagttgtactgcttccagttcctgcccttt
ggcaaaggcctcatcaagaagtgccggaccagccctgatgcctttgtgcagatcgcgctg
cagctggctcacttccgggacaggggtaagttctgcctgacctatgaggcctcaatgacc
agaatgttccgggagggacggactgagactgtgcgttcctgtaccagcgagtccacagcc
tttgtgcaggccatgatggaggggtcccacacaaaagcagacctgcgagatctcttccag
aaggctgctaagaagcaccagaatatgtaccgcctggccatgaccggggcagggatcgac
aggcacctcttctgcctttacttggtctccaagtacctaggagtcagctctcctttcctt
gctgaggtgctctcggaaccctggcgtctctccaccagccagatcccccaatcccagatc
cgcatgttcgacccagagcagcaccccaatcacctgggcgctggaggtggctttggccct
gtagcagatgatggctatggagtttcctacatgattgcaggcgagaacacgatcttcttc
cacatctccagcaagttctcaagctcagagacgaacgcccagcgctttggaaaccacatc
cgcaaagccctgctggacattgctgatcttttccaagttcccaaggcctacagctga

DBGET integrated database retrieval system