KEGG   Homo sapiens (human): 1385Help
Entry
1385              CDS       T01001                                 

Gene name
CREB1, CREB, CREB-1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Insulin resistance
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1385 (CREB1)
   04024 cAMP signaling pathway
    1385 (CREB1)
   04022 cGMP - PKG signaling pathway
    1385 (CREB1)
   04151 PI3K-Akt signaling pathway
    1385 (CREB1)
   04152 AMPK signaling pathway
    1385 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    1385 (CREB1)
  Endocrine system
   04911 Insulin secretion
    1385 (CREB1)
   04922 Glucagon signaling pathway
    1385 (CREB1)
   04915 Estrogen signaling pathway
    1385 (CREB1)
   04918 Thyroid hormone synthesis
    1385 (CREB1)
   04916 Melanogenesis
    1385 (CREB1)
   04924 Renin secretion
    1385 (CREB1)
   04925 Aldosterone synthesis and secretion
    1385 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1385 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    1385 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    1385 (CREB1)
   04728 Dopaminergic synapse
    1385 (CREB1)
  Development
   04380 Osteoclast differentiation
    1385 (CREB1)
  Aging
   04211 Longevity regulating pathway - mammal
    1385 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    1385 (CREB1)
   04713 Circadian entrainment
    1385 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1385 (CREB1)
   05215 Prostate cancer
    1385 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    1385 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    1385 (CREB1)
   05031 Amphetamine addiction
    1385 (CREB1)
   05034 Alcoholism
    1385 (CREB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    1385 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    1385 (CREB1)
   05166 HTLV-I infection
    1385 (CREB1)
   05161 Hepatitis B
    1385 (CREB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    1385 (CREB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    1385 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q34
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagcagccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system