KEGG   Homo sapiens (human): 1386Help
Entry
1386              CDS       T01001                                 

Gene name
ATF2, CRE-BP1, CREB-2, CREB2, HB16, TREB7
Definition
activating transcription factor 2 (EC:2.3.1.48)
Orthology
K04450  
cyclic AMP-dependent transcription factor ATF-2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1386 (ATF2)
   04668 TNF signaling pathway
    1386 (ATF2)
   04022 cGMP - PKG signaling pathway
    1386 (ATF2)
   04151 PI3K-Akt signaling pathway
    1386 (ATF2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    1386 (ATF2)
   04915 Estrogen signaling pathway
    1386 (ATF2)
   04918 Thyroid hormone synthesis
    1386 (ATF2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1386 (ATF2)
  Nervous system
   04728 Dopaminergic synapse
    1386 (ATF2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1386 (ATF2)
  Substance dependence
   05030 Cocaine addiction
    1386 (ATF2)
   05031 Amphetamine addiction
    1386 (ATF2)
   05034 Alcoholism
    1386 (ATF2)
  Infectious diseases
   05166 HTLV-I infection
    1386 (ATF2)
   05164 Influenza A
    1386 (ATF2)
   05161 Hepatitis B
    1386 (ATF2)
   05169 Epstein-Barr virus infection
    1386 (ATF2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    1386 (ATF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32
AA seq 505 aa AA seqDB search
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgtactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcgagtccatttgagaatgaattcaagaaagcttca
gaagatgacattaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcctctccccaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttaggactcagtcagaggaatctcgaccgcagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaagtacaagt
ggtcgtcggagaagagcagctaacgaagatcctgatgaaaaaaggagaaagtttttagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagctgaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
atttcagtgccgagtagtccacatacagaagctatacagcatagttcggtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagtca
cagccctcaggaagttga

DBGET integrated database retrieval system