KEGG   Homo sapiens (human): 1387Help
Entry
1387              CDS       T01001                                 

Gene name
CREBBP, CBP, KAT3A, RSTS, RSTS1
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04520  Adherens junction
hsa04630  Jak-STAT signaling pathway
hsa04720  Long-term potentiation
hsa04916  Melanogenesis
hsa04919  Thyroid hormone signaling pathway
hsa04922  Glucagon signaling pathway
hsa05016  Huntington's disease
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05215  Prostate cancer
Network
N00149  TLR3-IRF3 signaling pathway
N00161  KSHV vIRF1/2 to TLR3-IRF3 signaling pathway
N00193  HPV E6 to host-cell-protein inhibition
N00221  HTLV-I Tax to host-cell-protein activation
N00225  EBV EBNA2 binding to host-cell-protein
Disease
H00504  Rubinstein-Taybi syndrome
H01613  Follicular lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1387 (CREBBP)
   04330 Notch signaling pathway
    1387 (CREBBP)
   04350 TGF-beta signaling pathway
    1387 (CREBBP)
   04630 Jak-STAT signaling pathway
    1387 (CREBBP)
   04066 HIF-1 signaling pathway
    1387 (CREBBP)
   04068 FoxO signaling pathway
    1387 (CREBBP)
   04024 cAMP signaling pathway
    1387 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1387 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    1387 (CREBBP)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    1387 (CREBBP)
   04919 Thyroid hormone signaling pathway
    1387 (CREBBP)
   04916 Melanogenesis
    1387 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    1387 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1387 (CREBBP)
   05206 MicroRNAs in cancer
    1387 (CREBBP)
   05203 Viral carcinogenesis
    1387 (CREBBP)
   05211 Renal cell carcinoma
    1387 (CREBBP)
   05215 Prostate cancer
    1387 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    1387 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    1387 (CREBBP)
   05166 HTLV-I infection
    1387 (CREBBP)
   05164 Influenza A
    1387 (CREBBP)
   05161 Hepatitis B
    1387 (CREBBP)
   05168 Herpes simplex infection
    1387 (CREBBP)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1387 (CREBBP)
   05169 Epstein-Barr virus infection
    1387 (CREBBP)
   05165 Human papillomavirus infection
    1387 (CREBBP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     1387 (CREBBP)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    1387 (CREBBP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    1387 (CREBBP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    1387 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 1387
NCBI-ProteinID: NP_004371
OMIM: 600140
HGNC: 2348
Ensembl: ENSG00000005339
Vega: OTTHUMG00000129431
Pharos: Q92793(Tchem)
UniProt: Q92793
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 2442 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHT
NNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNS
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAG
MAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacttgctggacggaccgcccaaccccaaaagagccaaactcagctcgccc
ggtttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcggctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgctaacatggccagcctcagtgccatgggcaag
agccctctgagccagggagattcttcagcccccagcctgcctaaacaggcagccagcacc
tctgggcccacccccgctgcctcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggcgactagcagccctgccacgtcacagactggacctggtatctgcatgaatgctaac
tttaaccagacccacccaggcctcctcaatagtaactctggccatagcttaattaatcag
gcttcacaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagctggaatgccgtaccctactccagccatgcagggcgcctcgagcagcgtgctggct
gagaccctaacgcaggtttccccgcaaatgactggtcacgcgggactgaacaccgcacag
gcaggaggcatggccaagatgggaataactgggaacacaagtccatttggacagcccttt
agtcaagctggagggcagccaatgggagccactggagtgaacccccagttagccagcaaa
cagagcatggtcaacagtttgcccaccttccctacagatatcaagaatacttcagtcacc
aacgtgccaaatatgtctcagatgcaaacatcagtgggaattgtacccacacaagcaatt
gcaacaggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcatgctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgc
tcgctcccgcattgtcgaaccatgaaaaacgttttgaatcacatgacgcattgtcaggct
gggaaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacagggcaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcagcgagcctatgctgctctcggactcccctacatgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaacccaccagcagatgaggact
ctcaaccccctgggaaataatccaatgaacattccagcaggaggaataacaacagatcag
cagcccccaaacttgatttcagaatcagctcttccgacttccctgggggccacaaaccca
ctgatgaacgatggctccaactctggtaacattggaaccctcagcactataccaacagca
gctcctccttctagcaccggtgtaaggaaaggctggcacgaacatgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccatcttcccaacacctgatcccgcagct
ctaaaggatcgccgcatggaaaacctggtagcctatgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatattatcacttattagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggaggtcgcgtttacataaacaaggcatcttgggg
aaccagccagccttaccagccccgggggctcagccccctgtgattccacaggcacaacct
gtgagacctccaaatggacccctgtccctgccagtgaatcgcatgcaagtttctcaaggg
atgaattcatttaaccccatgtccttggggaacgtccagttgccacaagcacccatggga
cctcgtgcagcctccccaatgaaccactctgtccagatgaacagcatgggctcagtgcca
gggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggtgcacacacc
aacaacatgatggcccaggcgcccgctcagagccagtttctgccacagaaccagttcccg
tcatccagcggggcgatgagtgtgggcatggggcagccgccagcccaaacaggcgtgtca
cagggacaggtgcctggtgctgctcttcctaaccctctcaacatgctggggcctcaggcc
agccagctaccttgccctccagtgacacagtcaccactgcacccaacaccgcctcctgct
tccacggctgctggcatgccatctctccagcacacgacaccacctgggatgactcctccc
cagccagcagctcccactcagccatcaactcctgtgtcgtcttccgggcagactcccacc
ccgactcctggctcagtgcccagtgctacccaaacccagagcacccctacagtccaggca
gcagcccaggcccaggtgaccccgcagcctcaaaccccagttcagcccccgtctgtggct
acccctcagtcatcgcagcaacagccgacgcctgtgcacgcccagcctcctggcacaccg
ctttcccaggcagcagccagcattgataacagagtccctaccccctcctcggtggccagc
gcagaaaccaattcccagcagccaggacctgacgtacctgtgctggaaatgaagacggag
acccaagcagaggacactgagcccgatcctggtgaatccaaaggggagcccaggtctgag
atgatggaggaggatttgcaaggagcttcccaagttaaagaagaaacagacatagcagag
cagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaagttaaa
gaggaagaagagagtagcagtaacggcacagcctctcagtcaacatctccttcgcagccg
cgcaaaaaaatctttaaaccagaggagttacgccaggccctcatgccaaccctagaagca
ctgtatcgacaggacccagagtcattacctttccggcagcctgtagatccccagctcctc
ggaattccagactattttgacatcgtaaagaatcccatggacctctccaccatcaagcgg
aagctggacacagggcaataccaagagccctggcagtacgtggacgacgtctggctcatg
ttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttttgcagtaag
cttgcagaggtctttgagcaggaaattgaccctgtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctgtgtacc
attcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccccagacg
acaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagaccccgaacctttc
gttgattgcaaggagtgtggccggaagatgcatcagatttgcgttctgcactatgacatc
atttggccttcaggttttgtgtgcgacaactgcttgaagaaaactggcagacctcgaaaa
gaaaacaaattcagtgctaagaggctgcagaccacaagactgggaaaccacttggaagac
cgagtgaacaaatttttgcggcgccagaatcaccctgaagccggggaggtttttgtccga
gtggtggccagctcagacaagacggtggaggtcaagcccgggatgaagtcacggtttgtg
gattctggggaaatgtctgaatctttcccatatcgaaccaaagctctgtttgcttttgag
gaaattgacggcgtggatgtctgcttttttggaatgcacgtccaagaatacggctctgat
tgcccccctccaaacacgaggcgtgtgtacatttcttatctggatagtattcatttcttc
cggccacgttgcctccgcacagccgtttaccatgagatccttattggatatttagagtat
gtgaagaaattagggtatgtgacagggcacatctgggcctgtcctccaagtgaaggagat
gattacatcttccattgccacccacctgatcaaaaaatacccaagccaaaacgactgcag
gagtggtacaaaaagatgctggacaaggcgtttgcagagcggatcatccatgactacaag
gatattttcaaacaagcaactgaagacaggctcaccagtgccaaggaactgccctatttt
gaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaa
gaggagaggaaaaaggaagagagcactgcagccagtgaaaccactgagggcagtcagggc
gacagcaagaatgccaagaagaagaacaacaagaaaaccaacaagaacaaaagcagcatc
agccgcgccaacaagaagaagcccagcatgcccaacgtgtccaatgacctgtcccagaag
ctgtatgccaccatggagaagcacaaggaggtcttcttcgtgatccacctgcacgctggg
cctgtcatcaacaccctgccccccatcgtcgaccccgaccccctgctcagctgtgacctc
atggatgggcgcgacgccttcctcaccctcgccagagacaagcactgggagttctcctcc
ttgcgccgctccaagtggtccacgctctgcatgctggtggagctgcacacccagggccag
gaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
actgtgtgcgaggactacgacctctgcatcaactgctataacacgaagagccatgcccat
aagatggtgaagtgggggctgggcctggatgacgagggcagcagccagggcgagccacag
tcaaagagcccccaggagtcacgccggctgagcatccagcgctgcatccagtcgctggtg
cacgcgtgccagtgccgcaacgccaactgctcgctgccatcctgccagaagatgaagcgg
gtggtgcagcacaccaagggctgcaaacgcaagaccaacgggggctgcccggtgtgcaag
cagctcatcgccctctgctgctaccacgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttctcctacctcagcaccgcccgggacccccacacagcagcccagcacaccc
cagacgccgcagccccctgcccagccccaaccctcacccgtgagcatgtcaccagctggc
ttccccagcgtggcccggactcagccccccaccacggtgtccacagggaagcctaccagc
caggtgccggcccccccacccccggcccagccccctcctgcagcggtggaagcggctcgg
cagatcgagcgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaacagc
atgcccccaggacgcacgggcatggggaccccggggagccagatggcccccgtgagcctg
aatgtgccccgacccaaccaggtgagcgggcccgtcatgcccagcatgcctcccgggcag
tggcagcaggcgccccttccccagcagcagcccatgccaggcttgcccaggcctgtgata
tccatgcaggcccaggcggccgtggctgggccccggatgcccagcgtgcagccacccagg
agcatctcacccagcgctctgcaagacctgctgcggaccctgaagtcgcccagctcccct
cagcagcaacagcaggtgctgaacattctcaaatcaaacccgcagctaatggcagctttc
atcaaacagcgcacagccaagtacgtggccaatcagcccggcatgcagccccagcctggc
ctccagtcccagcccggcatgcaaccccagcctggcatgcaccagcagcccagcctgcag
aacctgaatgccatgcaggctggcgtgccgcggcccggtgtgcctccacagcagcaggcg
atgggaggcctgaacccccagggccaggccttgaacatcatgaacccaggacacaacccc
aacatggcgagtatgaatccacagtaccgagaaatgttacggaggcagctgctgcagcag
cagcagcaacagcagcagcaacaacagcagcaacagcagcagcagcaagggagtgccggc
atggctgggggcatggcggggcacggccagttccagcagcctcaaggacccggaggctac
ccaccggccatgcagcagcagcagcgcatgcagcagcatctccccctccagggcagctcc
atgggccagatggcggctcagatgggacagcttggccagatggggcagccggggctgggg
gcagacagcacccccaacatccagcaagccctgcagcagcggattctgcagcaacagcag
atgaagcagcagattgggtccccaggccagccgaaccccatgagcccccagcaacacatg
ctctcaggacagccacaggcctcgcatctccctggccagcagatcgccacgtcccttagt
aaccaggtgcggtctccagcccctgtccagtctccacggccccagtcccagcctccacat
tccagcccgtcaccacggatacagccccagccttcgccacaccacgtctcaccccagact
ggttccccccaccccggactcgcagtcaccatggccagctccatagatcagggacacttg
gggaaccccgaacagagtgcaatgctcccccagctgaacacccccagcaggagtgcgctg
tccagcgaactgtccctggtcggggacaccacgggggacacgctagagaagtttgtggag
ggcttgtag

DBGET integrated database retrieval system