KEGG   Homo sapiens (human): 1392Help
Entry
1392              CDS       T01001                                 

Gene name
CRH, CRF, CRH1
Definition
(RefSeq) corticotropin releasing hormone
  KO
K05256  corticotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04730  Long-term depression
hsa04934  Cushing's syndrome
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04730 Long-term depression
    1392 (CRH)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    1392 (CRH)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1392 (CRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CRF
Motif
Other DBs
NCBI-GeneID: 1392
NCBI-ProteinID: NP_000747
OMIM: 122560
HGNC: 2355
Ensembl: ENSG00000147571
Vega: OTTHUMG00000164474
Pharos: P06850(Tbio)
UniProt: P06850 A0A0S2Z478
Structure
PDB: 

Jmol
Position
8q13.1
AA seq 196 aa AA seqDB search
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL
LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL
AQQAHSNRKLMEIIGK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgccgctgcttgtgtccgcgggagtcctgctggtggctctcctgccctgcccg
ccatgcagggcgctcctgagccgcgggccggtcccgggagctcggcaggcgccgcagcac
cctcagcccttggatttcttccagccgccgccgcagtccgagcagccccagcagccgcag
gctcggccggtcctgctccgcatgggagaggagtacttcctccgcctggggaacctcaac
aagagcccggccgctcccctttcgcccgcctcctcgctcctcgccggaggcagcggcagc
cgcccttcgccggaacaggcgaccgccaactttttccgcgtgttgctgcagcagctgctg
ctgcctcggcgctcgctcgacagccccgcggctctcgcggagcgcggcgctaggaatgcc
ctcggcggccaccaggaggcaccggagagagaaaggcggtccgaggagcctcccatctcc
ctggatctcaccttccacctcctccgggaagtcttggaaatggccagggccgagcagtta
gcacagcaagctcacagcaacaggaaactcatggagattattgggaaataa

DBGET integrated database retrieval system