KEGG   Homo sapiens (human): 1392Help
Entry
1392              CDS       T01001                                 

Gene name
CRH, CRF
Definition
corticotropin releasing hormone
Orthology
K05256  
corticotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
Long-term depression
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1392 (CRH)
 Organismal Systems
  Nervous system
   04730 Long-term depression
    1392 (CRH)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    1392 (CRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q13
AA seq 196 aa AA seqDB search
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL
LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL
AQQAHSNRKLMEIIGK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgccgctgcttgtgtccgcgggagtcctgctggtggctctcctgccctgcccg
ccatgcagggcgctcctgagccgcgggccggtcccgggagctcggcaggcgccgcagcac
cctcagcccttggatttcttccagccgccgccgcagtccgagcagccccagcagccgcag
gctcggccggtcctgctccgcatgggagaggagtacttcctccgcctggggaacctcaac
aagagcccggccgctcccctttcgcccgcctcctcgctcctcgccggaggcagcggcagc
cgcccttcgccggaacaggcgaccgccaactttttccgcgtgttgctgcagcagctgctg
ctgcctcggcgctcgctcgacagccccgcggctctcgcggagcgcggcgctaggaatgcc
ctcggcggccaccaggaggcaccggagagagaaaggcggtccgaggagcctcccatctcc
ctggatctcaccttccacctcctccgggaagtcttggaaatggccagggccgagcagtta
gcacagcaagctcacagcaacaggaaactcatggagattattgggaaataa

DBGET integrated database retrieval system