KEGG   Homo sapiens (human): 139728Help
Entry
139728            CDS       T01001                                 

Gene name
PNCK, BSTK3, CaMK1b
Definition
(RefSeq) pregnancy up-regulated nonubiquitous CaM kinase
  KO
K08795  
pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     139728 (PNCK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK1 family [OT]
   139728 (PNCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6P2M8(Tbio)
UniProt: 
Position
Xq28
AA seq 360 aa AA seqDB search
MWRRVCGGLAGRRPSGDMLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVAL
KCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIM
ERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKI
QAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQ
ILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDILGS
VSEQIRKNFARTHWKRAFNATSFLRHIRKLGQIPEGEGASEQGMARHSHSGLRAGQPPKW
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggcgtgtatgcggtggcctcgctgggaggcgtccgtctggggacatgctgctg
ctgaagaaacacacggaggacatcagcagcgtctacgagatccgcgagaggctcggctcg
ggtgccttctccgaggtggtgctggcccaggagcggggctccgcacacctcgtggccctc
aagtgcatccccaagaaggccctccggggcaaggaggccctggtggagaacgagatcgca
gtgctccgtaggatcagtcaccccaacatcgtcgctctggaggatgtccacgagagccct
tcccacctctacctggccatggaactggtgacgggtggcgagctgtttgaccgcatcatg
gagcgcggctcctacacagagaaggatgccagccatctggtgggtcaggtccttggcgcc
gtctcctacctgcacagcctggggatcgtgcaccgggacctcaagcccgaaaacctcctg
tatgccacgccctttgaggactcgaagatcatggtctctgactttggactctccaaaatc
caggctgggaacatgctaggcaccgcctgtgggacccctggatatgtggccccagagctc
ttggagcagaaaccctacgggaaggccgtagatgtgtgggccctgggcgtcatctcctac
atcctgctgtgtgggtacccccccttctacgacgagagcgaccctgagctcttcagccag
atcctgagggccagctatgagtttgactctcctttctgggatgacatctcagaatcagcc
aaagacttcatccggcaccttctggagcgagacccccagaagaggttcacctgccaacag
gccttgcggcacctttggatctctggggacacagccttcgacagggacatcttaggctct
gtcagtgagcagatccggaagaactttgctcggacacactggaagcgagccttcaatgcc
acctcgttcctgcgccacatccggaagctggggcagatcccagagggcgagggggcctct
gagcagggcatggcccgccacagccactcaggcctccgtgctggccagccccccaagtgg
tga

DBGET integrated database retrieval system