KEGG   Homo sapiens (human): 1398Help
Entry
1398              CDS       T01001                                 

Gene name
CRK, CRKII, p38
Definition
v-crk avian sarcoma virus CT10 oncogene homolog
Orthology
K04438  
proto-oncogene C-crk
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Bacterial invasion of epithelial cells
Shigellosis
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1398 (CRK)
   04010 MAPK signaling pathway
    1398 (CRK)
   04012 ErbB signaling pathway
    1398 (CRK)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1398 (CRK)
  Cell communication
   04510 Focal adhesion
    1398 (CRK)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1398 (CRK)
   04062 Chemokine signaling pathway
    1398 (CRK)
  Endocrine system
   04910 Insulin signaling pathway
    1398 (CRK)
  Nervous system
   04722 Neurotrophin signaling pathway
    1398 (CRK)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1398 (CRK)
   05206 MicroRNAs in cancer
    1398 (CRK)
   05220 Chronic myeloid leukemia
    1398 (CRK)
   05211 Renal cell carcinoma
    1398 (CRK)
  Infectious diseases
   05131 Shigellosis
    1398 (CRK)
   05100 Bacterial invasion of epithelial cells
    1398 (CRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 204 aa AA seqDB search
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggaggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtcggtga

DBGET integrated database retrieval system