KEGG   Homo sapiens (human): 140Help
Entry
140               CDS       T01001                                 

Gene name
ADORA3, A3AR, AD026, bA552M11.5
Definition
adenosine A3 receptor
Orthology
K04268  
adenosine A3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Adenosine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    140 (ADORA3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140 (ADORA3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    140 (ADORA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.2
AA seq 318 aa AA seqDB search
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaacagcactgctctgtcattggccaatgttacctacatcaccatggaaatt
ttcattggactctgcgccatagtgggcaacgtgctggtcatctgcgtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctctctagccctggctgacattgct
gttggggtgctggtcatgcctttggccattgttgtcagcctgggcatcacaatccacttc
tacagctgcctttttatgacttgcctactgcttatctttacccacgcctccatcatgtcc
ttgctggccatcgctgtggaccgatacttgcgggtcaagcttaccgtcagatacaagagg
gtcaccactcacagaagaatatggctggccctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgacctcagagtaccacagaaat
gtcaccttcctttcatgccaatttgtttccgtcatgagaatggactacatggtatacttc
agcttcctcacctggattttcatccccctggttgtcatgtgcgccatctatcttgacatc
ttttacatcattcggaacaaactcagtctgaacttatctaactccaaagagacaggtgca
ttttatggacgggagttcaagacggctaagtccttgtttctggttcttttcttgtttgct
ctgtcatggctgcctttatctatcatcaactgcatcatctactttaatggtgaggtacca
cagcttgtgctgtacatgggcatcctgctgtcccatgccaactccatgatgaaccctatc
gtctatgcctataaaataaagaagttcaaggaaacctaccttttgatcctcaaagcttgt
gtggtctgccatccctctgattctttggacacaagcattgagaagaattctgagtag

DBGET integrated database retrieval system