KEGG   Homo sapiens (human): 140Help
Entry
140               CDS       T01001                                 

Gene name
ADORA3, A3AR
Definition
(RefSeq) adenosine A3 receptor
  KO
K04268  adenosine A3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Piclidenoson: D10971
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    140 (ADORA3)
   04022 cGMP - PKG signaling pathway
    140 (ADORA3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140 (ADORA3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    140 (ADORA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx PapG_N
Motif
Other DBs
NCBI-GeneID: 140
NCBI-ProteinID: NP_000668
OMIM: 600445
HGNC: 268
Ensembl: ENSG00000282608
Vega: OTTHUMG00000011957
Pharos: P0DMS8(Tchem)
UniProt: P0DMS8
Position
1p13.2
AA seq 318 aa AA seqDB search
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaacagcactgctctgtcattggccaatgttacctacatcaccatggaaatt
ttcattggactctgcgccatagtgggcaacgtgctggtcatctgcgtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctctctagccctggctgacattgct
gttggggtgctggtcatgcctttggccattgttgtcagcctgggcatcacaatccacttc
tacagctgcctttttatgacttgcctactgcttatctttacccacgcctccatcatgtcc
ttgctggccatcgctgtggaccgatacttgcgggtcaagcttaccgtcagatacaagagg
gtcaccactcacagaagaatatggctggccctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgacctcagagtaccacagaaat
gtcaccttcctttcatgccaatttgtttccgtcatgagaatggactacatggtatacttc
agcttcctcacctggattttcatccccctggttgtcatgtgcgccatctatcttgacatc
ttttacatcattcggaacaaactcagtctgaacttatctaactccaaagagacaggtgca
ttttatggacgggagttcaagacggctaagtccttgtttctggttcttttcttgtttgct
ctgtcatggctgcctttatctatcatcaactgcatcatctactttaatggtgaggtacca
cagcttgtgctgtacatgggcatcctgctgtcccatgccaactccatgatgaaccctatc
gtctatgcctataaaataaagaagttcaaggaaacctaccttttgatcctcaaagcttgt
gtggtctgccatccctctgattctttggacacaagcattgagaagaattctgagtag

DBGET integrated database retrieval system