KEGG   Homo sapiens (human): 1407Help
Entry
1407              CDS       T01001                                 

Gene name
CRY1, PHLL1
Definition
(RefSeq) cryptochrome circadian clock 1
  KO
K02295  
cryptochrome
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    1407 (CRY1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    1407 (CRY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q16526(Tbio)
UniProt: 
Position
12q23.3
AA seq 586 aa AA seqDB search
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYA
HGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgaacgccgtgcactggttccgaaaggggctccggctccacgacaaccccgcc
ctgaaggagtgcattcagggcgccgacaccatccgctgcgtctacatcctggacccctgg
ttcgccggctcctccaatgtgggcatcaacaggtggcgatttttgcttcagtgtcttgag
gatcttgatgccaatctacgaaaattaaactcccgtctgtttgtgattcgtggacaacca
gcagatgtgtttcccaggcttttcaaggaatggaacattactaaactttcaattgagtat
gattctgagccctttggaaaggaacgagacgcagctattaagaaactggcaactgaagct
ggagtagaagtcattgtaagaatttcacatacattatatgacctagacaagatcatagaa
ctcaatggtggacaaccgcctctaacttataaaagattccagactctcatcagcaaaatg
gaaccactagagataccagtagagacaattacttcagaagtgatagaaaagtgcacaact
cctctgtctgatgaccatgatgagaaatatggagtcccttcactggaagagctaggtttt
gatacagatggcttatcctctgcagtgtggccaggtggagaaactgaagcacttactcgt
ttggaaaggcatttggaaagaaaagcttgggtggcaaattttgaaagacctcgaatgaat
gcgaattctctgcttgcaagccctactggacttagtccttatctccgatttggttgtttg
tcatgtcgactgttttacttcaaactaacagatctctacaaaaaggtaaagaagaacagt
tcccctcccctttccctttatgggcaactgttatggcgtgaatttttctatacagcagca
acaaataatccacgctttgataaaatggaaggaaaccctatctgtgttcagattccttgg
gataaaaatcctgaggctttagccaaatgggcggaaggccggacaggctttccatggatt
gatgccatcatgacacagcttcgtcaggagggttggattcatcatctagccaggcatgca
gttgcttgcttcctgacacgaggggacctgtggattagttgggaagaaggaatgaaggta
tttgaagaattattgcttgatgcagattggagcataaatgctggaagttggatgtggctg
tcttgtagttccttttttcaacagttttttcactgctattgccctgttggttttggtagg
agaacagatcccaatggagactatatcaggcgttatttgcctgtcctaagaggcttccct
gcaaaatatatctatgatccctggaatgcaccagaaggtatccaaaaggtagccaaatgt
ttgataggagttaattatcctaaaccaatggtgaaccatgctgaggcaagccgtttgaat
atcgaaaggatgaaacagatctatcagcagctttcacgatatagaggactaggtcttctg
gcatcagtaccttctaatcctaatgggaatggaggcttcatgggatattctgcagaaaat
atcccaggttgtagcagcagtggaagttgctctcaagggagtggtattttacactatgct
catggcgacagtcagcaaactcacctgttgaagcaaggaagaagctccatgggcactggt
ctcagtggtgggaaacgtcctagtcaggaagaggacacacagagtattggtcctaaagtc
cagagacagagcactaattag

DBGET integrated database retrieval system