KEGG   Homo sapiens (human): 1408Help
Entry
1408              CDS       T01001                                 

Gene name
CRY2, HCRY2, PHLL2
Definition
(RefSeq) cryptochrome circadian clock 2
  KO
K02295  
cryptochrome
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    1408 (CRY2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    1408 (CRY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q49AN0(Tbio)
UniProt: 
Position
11p11.2
AA seq 614 aa AA seqDB search
MGGVHVAYRGGAGVAGAVWTVMAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPA
LLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQP
ADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIE
LNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGF
PTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCL
SCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPW
DRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRV
FDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFP
SRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLL
ASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRAR
VAELPTPELPSKDA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggtccacgtcgcctaccggggcggagcgggggtggctggagcagtctggaca
gtcatggcggcgactgtggcgacggcggcagctgtggccccggcgccagcgcccggcacg
gacagcgcctcttcggtgcactggttccgcaaagggctgcgactccacgacaacccggcg
ttgctggcggccgtgcgcggggcgcgctgcgtgcgctgcgtttacattctcgacccgtgg
ttcgcggcctcctcctcagtcgggatcaaccgatggaggttcctacttcagtctctggaa
gatttggacacaagtttaaggaaactgaactcccgcctgtttgtagtccggggacagcca
gccgacgtgttcccaaggctgttcaaggaatggggagtgacccgcttgacctttgaatat
gactctgaaccctttgggaaagaacgggatgcagccatcatgaagatggccaaggaggct
ggtgtggaagtagtgacggagaattctcataccctctatgacctggacaggatcattgag
ctgaatgggcagaagccaccccttacatacaagcgctttcaggccatcatcagccgcatg
gagctgcccaagaagccagtgggcttggtgaccagccagcagatggagagctgcagggcc
gagatccaggagaaccacgacgagacctacggcgtgccctccctggaggagctggggttc
cccactgaaggacttggtccagctgtctggcagggaggagagacagaagctctggcccgc
ctggataagcacttggaacggaaggcctgggttgccaactatgagagaccccgaatgaac
gccaactccctcctggccagccccacaggcctcagcccctacctgcgctttggttgtctc
tcctgccgcctcttctactaccgcctgtgggacctgtataaaaaggtgaagcggaacagc
acacctcccctctccctatttgggcaactcctatggcgagagttcttctacacggcagct
accaacaaccccaggtttgaccgcatggaggggaaccccatctgcatccagatcccctgg
gaccgcaatcctgaggccctggccaagtgggctgagggcaagacaggcttcccttggatt
gatgccatcatgacccaactgaggcaggagggctggatccaccacctggcccggcatgcc
gtggcctgcttcctgacccgcggggacctctgggtcagctgggagagcggggtccgggta
tttgatgagctgctcctggatgcagatttcagcgtgaacgcaggcagctggatgtggctg
tcctgcagtgctttcttccagcagttcttccactgctactgccctgtgggctttggccgt
cgcacggaccccagtggggactacatcaggcgatacctgcccaaattgaaagcgttcccc
tctcgatacatctatgagccctggaatgccccagagtcaattcagaaggcagccaagtgc
atcattggtgtggactacccacggcccatcgtcaaccatgccgagaccagccggcttaac
attgaacgaatgaagcagatttaccagcagctttcgcgctaccggggactctgtctactg
gcatctgtcccttcctgtgtggaagacctcagtcaccctgtggcagagcccagctcgagc
caggctggcagcatgagcagtgcaggcccaagaccactacccagtggcccagcatccccc
aaacgcaagctggaagcagccgaggaaccacctggtgaagaactcagcaaacgggcccgg
gtggcagagttgccaaccccagagctgccgagcaaggatgcctga

DBGET integrated database retrieval system