KEGG   Homo sapiens (human): 1432Help
Entry
1432              CDS       T01001                                 

Gene name
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Definition
mitogen-activated protein kinase 14 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1432 (MAPK14)
   04010 MAPK signaling pathway
    1432 (MAPK14)
   04370 VEGF signaling pathway
    1432 (MAPK14)
   04668 TNF signaling pathway
    1432 (MAPK14)
   04068 FoxO signaling pathway
    1432 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    1432 (MAPK14)
   04620 Toll-like receptor signaling pathway
    1432 (MAPK14)
   04621 NOD-like receptor signaling pathway
    1432 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    1432 (MAPK14)
   04660 T cell receptor signaling pathway
    1432 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    1432 (MAPK14)
   04670 Leukocyte transendothelial migration
    1432 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    1432 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    1432 (MAPK14)
   04917 Prolactin signaling pathway
    1432 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1432 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    1432 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    1432 (MAPK14)
   04722 Neurotrophin signaling pathway
    1432 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1432 (MAPK14)
  Development
   04380 Osteoclast differentiation
    1432 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    1432 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    1432 (MAPK14)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1432 (MAPK14)
   05132 Salmonella infection
    1432 (MAPK14)
   05131 Shigellosis
    1432 (MAPK14)
   05133 Pertussis
    1432 (MAPK14)
   05152 Tuberculosis
    1432 (MAPK14)
   05164 Influenza A
    1432 (MAPK14)
   05160 Hepatitis C
    1432 (MAPK14)
   05169 Epstein-Barr virus infection
    1432 (MAPK14)
   05145 Toxoplasmosis
    1432 (MAPK14)
   05140 Leishmaniasis
    1432 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    1432 (MAPK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     1432 (MAPK14)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   1432 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
2FST 4EHV 3ZS5 3OEF 3ROC 3K3I 3FMK 2QD9 2FSL 2RG6 2GFS 4AA0 3S3I 3KQ7 3HUC 3GC7 3FLY 3FL4 2ZAZ 2NPQ 2FSO 4F9Y 2FSM 4E5A 3HL7 3ZSG 3NNW 3MPT 3ZYA 3FMH 3FMN 3FLN 3FLQ 3D83 4DLI 2Y8O 3HV6 3HLL 4KIN 4F9W 4FA2 4EH2 4EH5 4E5B 2YIW 2YIS 3QUD 3O8T 3MVM 3MH0 3KF7 3K3J 3FSK 3FMJ 3FMM 3FKL 3FKN 3FKO 3E92 3E93 2OKR 2I0H 1ZZL 1ZZ2 1ZYJ 1YQJ 1R3C 1IAN 3ZSH 4E6A 3NWW 4L8M 4EWQ 4EH6 4EH7 4EH9 3UVR 3O8P 3O8U 3NNV 3MPA 3MGY 3LFA 3IPH 3HVC 3GFE 3GCU 3FSF 3FML 3FLW 3D7Z 2ZB0 2BAL 1OZ1 1OVE 3U8W 3HP2 1WBO 4EH8 3UVQ 4A9Y 3RIN 3ODY 3MH1 3MH3 3HRB 3HEG 3FI4 2BAK 3OCG 1W7H 3FLZ 3ITZ 3HV5 2BAJ 4KIP 3S4Q 3NNX 4AA4 2YIX 3ODZ 3MH2 3HP5 3FLS 1R39 1WFC 4AA5 4E6C 4EH3 3UVP 3ZSI 3OBJ 3NNU 3L8X 3HV7 3GI3 3FC1 3BX5 3BV2 2RG5 1M7Q 1BMK 1WBW 3HA8 4KIQ 4EH4 4AAC 3HEC 2ZB1 1OUY 1OUK 1KV1 1BL7 1BL6 1A9U 3NEW 3OC1 3BV3 4DLJ 3HV4 1DI9 3OD6 4E8A 3QUE 3OBG 3MW1 3MVL 3DT1 3C5U 2BAQ 1KV2 3DS6 3LHJ 2ONL 2LGC 1WBS 1WBT 1WBV 1WBN 1W82 1W83 1W84
Thumbnails

Jmol
Position
6p21.3-p21.2
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system