KEGG   Homo sapiens (human): 1437Help
Entry
1437              CDS       T01001                                 

Gene name
CSF2, CSF, GMCSF
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
N00187  KSHV Kaposin B to p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1437 (CSF2)
   05221 Acute myeloid leukemia
    1437 (CSF2)
  Immune diseases
   05323 Rheumatoid arthritis
    1437 (CSF2)
  Infectious diseases
   05132 Salmonella infection
    1437 (CSF2)
   05166 HTLV-I infection
    1437 (CSF2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1437 (CSF2)
   05146 Amoebiasis
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   1437 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF
Motif
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Vega: OTTHUMG00000059637
Pharos: P04141(Tbio)
UniProt: P04141
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 144 aa AA seqDB search
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

DBGET integrated database retrieval system