KEGG   Homo sapiens (human): 1438Help
Entry
1438              CDS       T01001                                 

Gene name
CSF2RA, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, SMDP4
Definition
colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
Orthology
K05066  
granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
Disease
H01122  
Pulmonary alveolar proteinosis (PAP)
Drug target
Molgramostim: 
Sargramostim: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1438 (CSF2RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1438 (CSF2RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1438 (CSF2RA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1438 (CSF2RA)
Cellular antigens [BR:hsa04090]
 Proteins
  1438 (CSF2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.32 and Yp11.3
AA seq 400 aa AA seqDB search
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC
FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTA
AQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAAD
VRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcctg
atcccagagaaatcggatctgcgaacagtggcaccagcctctagtctcaatgtgaggttt
gactccaggacgatgaatttaagctgggactgccaagaaaacacaaccttcagcaagtgt
ttcttaactgacaagaagaacagagtcgtggaacccaggctcagtaacaacgaatgttcg
tgcacatttcgtgaaatttgtctgcatgaaggagtcacatttgaggttcacgtgaatact
agtcaaagaggatttcaacagaaactgctttatccaaattcaggaagggagggtaccgct
gctcagaatttctcctgtttcatctacaatgcggatttaatgaactgtacctgggcgagg
ggtccgacggccccccgtgacgtccagtattttttgtacatacgaaactcaaagagaagg
agggagatccggtgtccttattacatacaagactcaggaacccatgtgggatgtcacctg
gataacctgtcaggattaacgtctcgcaattactttctggttaacggaaccagccgagaa
attggcatccaattctttgattcacttttggacacaaagaaaatagaacgattcaaccct
cccagcaatgtcaccgtacgttgcaacacgacgcactgcctcgtacggtggaaacagccc
aggacctatcagaagctgtcgtacctggactttcagtaccagctggacgtccacagaaag
aatacccagcctggcacggaaaacctactgattaatgtttctggtgatttggaaaataga
tacaactttccaagctctgagcccagagcaaaacacagtgtgaagatcagagctgcagac
gtccgcatcttgaattggagctcctggagtgaagccattgaatttggttctgacgacggg
aacctcggctctgtgtacatttatgtgctcctaatcgtgggaacccttgtctgtggcatc
gtcctcggcttcctctttaaaaggttccttaggatacagcggctgttcccgccagttcca
cagatcaaagacaaactgaatgataaccatgaggtggaagacgagatcatctgggaggaa
ttcaccccagaggaagggaaaggctaccgcgaagaggtcttgaccgtgaaggaaattacc
tga

DBGET integrated database retrieval system