KEGG   Homo sapiens (human): 1440Help
Entry
1440              CDS       T01001                                 

Gene name
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Definition
colony stimulating factor 3 (granulocyte)
Orthology
K05423  
granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Malaria
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2-q12
AA seq 207 aa AA seqDB search
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

DBGET integrated database retrieval system