KEGG   Homo sapiens (human): 1440Help
Entry
1440              CDS       T01001                                 

Gene name
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Definition
colony stimulating factor 3 (granulocyte)
Orthology
K05423  
granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1440 (CSF3)
   04151 PI3K-Akt signaling pathway
    1440 (CSF3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1440 (CSF3)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1440 (CSF3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    1440 (CSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2-q12
AA seq 207 aa AA seqDB search
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

DBGET integrated database retrieval system