KEGG   Homo sapiens (human): 1445Help
Entry
1445              CDS       T01001                                 

Gene name
CSK
Definition
(RefSeq) c-src tyrosine kinase (EC:2.7.10.2)
  KO
K05728  
c-src tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Epithelial cell signaling in Helicobacter pylori infection
Drug target
Ponatinib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1445 (CSK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     1445 (CSK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Csk family
   1445 (CSK)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1445 (CSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.1
AA seq 450 aa AA seqDB search
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatacaggccgcctggccatccggtacagaatgtattgccaagtacaacttc
cacggcactgccgagcaggacctgcccttctgcaaaggagacgtgctcaccattgtggcc
gtcaccaaggaccccaactggtacaaagccaaaaacaaggtgggccgtgagggcatcatc
ccagccaactacgtccagaagcgggagggcgtgaaggcgggtaccaaactcagcctcatg
ccttggttccacggcaagatcacacgggagcaggctgagcggcttctgtacccgccggag
acaggcctgttcctggtgcgggagagcaccaactaccccggagactacacgctgtgcgtg
agctgcgacggcaaggtggagcactaccgcatcatgtaccatgccagcaagctcagcatc
gacgaggaggtgtactttgagaacctcatgcagctggtggagcactacacctcagacgca
gatggactctgtacgcgcctcattaaaccaaaggtcatggagggcacagtggcggcccag
gatgagttctaccgcagcggctgggccctgaacatgaaggagctgaagctgctgcagacc
atcgggaagggggagttcggagacgtgatgctgggcgattaccgagggaacaaagtcgcc
gtcaagtgcattaagaacgacgccactgcccaggccttcctggctgaagcctcagtcatg
acgcaactgcggcatagcaacctggtgcagctcctgggcgtgatcgtggaggagaagggc
gggctctacatcgtcactgagtacatggccaaggggagccttgtggactacctgcggtct
aggggtcggtcagtgctgggcggagactgtctcctcaagttctcgctagatgtctgcgag
gccatggaatacctggagggcaacaatttcgtgcatcgagacctggctgcccgcaatgtg
ctggtgtctgaggacaacgtggccaaggtcagcgactttggtctcaccaaggaggcgtcc
agcacccaggacacgggcaagctgccagtcaagtggacagcccctgaggccctgagagag
aagaaattctccactaagtctgacgtgtggagtttcggaatccttctctgggaaatctac
tcctttgggcgagtgccttatccaagaattcccctgaaggacgtcgtccctcgggtggag
aagggctacaagatggatgcccccgacggctgcccgcccgcagtctatgaagtcatgaag
aactgctggcacctggacgccgccatgcggccctccttcctacagctccgagagcagctt
gagcacatcaaaacccacgagctgcacctgtga

DBGET integrated database retrieval system