KEGG   Homo sapiens (human): 1452Help
Entry
1452              CDS       T01001                                 

Gene name
CSNK1A1, CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
Definition
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  
casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Human papillomavirus infection
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1452 (CSNK1A1)
   04340 Hedgehog signaling pathway
    1452 (CSNK1A1)
 Human Diseases
  Cancers
   05224 Breast cancer
    1452 (CSNK1A1)
  Infectious diseases
   05165 Human papillomavirus infection
    1452 (CSNK1A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1452 (CSNK1A1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   1452 (CSNK1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P48729(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 337 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtagcagcggctccaaggctgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatctatttggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaagctctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttctgggacctagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaac
ctcactggcactgcccgatatgctagcatcaatgcacatcttggtattgagcagagtcgc
cgagatgacatggaatcattaggatatgttttgatgtattttaatagaaccagcctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccacgcctgttgaagttttatgtaaggggtttcctgcagaatttgcgatgtactta
aactattgtcgtgggctacgctttgaggaagccccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccatcaatatgactacacatttgattggacaatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

DBGET integrated database retrieval system