KEGG   Homo sapiens (human): 1452Help
Entry
1452              CDS       T01001                                 

Gene name
CSNK1A1, CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
Definition
casein kinase 1, alpha 1 (EC:2.7.11.1)
Orthology
K08957  
casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1452 (CSNK1A1)
   04340 Hedgehog signaling pathway
    1452 (CSNK1A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1452 (CSNK1A1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   1452 (CSNK1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q32
AA seq 365 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtagcagcggctccaaggctgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatctatttggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaagctctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttctgggacctagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatatgctagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatcattaggatatgttttgatg
tattttaatagaaccagcctgccatggcaagggctaaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccacgcctgttgaagttttatgtaaggggttt
cctgcagaatttgcgatgtacttaaactattgtcgtgggctacgctttgaggaagcccca
gattacatgtatctgaggcagctattccgcattcttttcaggaccctgaaccatcaatat
gactacacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system