KEGG   Homo sapiens (human): 145226Help
Entry
145226            CDS       T01001                                 

Gene name
RDH12, LCA13, LCA3, RP53, SDR7C2
Definition
retinol dehydrogenase 12 (all-trans/9-cis/11-cis) (EC:1.1.1.-)
Orthology
K11153  
retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Disease
H00837  
Leber congenital amaurosis (LCR)
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.1
AA seq 316 aa AA seqDB search
MLVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELA
SRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLH
ILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHI
GKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRH
SSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTA
ERLWNVSCELLGIRWE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcaccttgggactgctcacctccttcttctcgttcctgtatatggtagctcca
tccatcaggaagttctttgctggtggagtgtgtagaacaaatgtgcagcttcctggcaag
gtagtggtgatcactggcgccaacacgggcattggcaaggagacggccagagagctcgct
agccgaggagcccgagtctatattgcctgcagagatgtactgaagggggagtctgctgcc
agtgaaatccgagtggatacaaagaactcccaggtgctggtgcggaaattggacctatcc
gacaccaaatctatccgagcctttgctgagggctttctggcagaggaaaagcagctccat
attctgatcaacaatgcgggagtaatgatgtgtccatattccaagacagctgatggcttt
gaaacccacctgggagtcaaccacctgggccacttcctcctcacctacctgctcctggag
cggctaaaggtgtctgcccctgcacgggtggttaatgtgtcctcggtggctcaccacatt
ggcaagattcccttccacgacctccagagcgagaagcgctacagcaggggttttgcctat
tgccacagcaagctggccaatgtgctttttactcgtgagctggccaagaggctccaaggc
accggggtcaccacctacgcagtgcacccaggcgtcgtccgctctgagctggtccggcac
tcctccctgctctgcctgctctggcggctcttctccccctttgtcaagacggcacgggag
ggggcgcagaccagcctgcactgcgccctggctgagggcctggagcccctgagtggcaag
tacttcagtgactgcaagaggacctgggtgtctccaagggcccgaaataacaaaacagct
gagcgcctatggaatgtcagctgtgagcttctaggaatccggtgggagtag

DBGET integrated database retrieval system